Dataset for protein BCL-2-like of organism Chlorocebus sabaeus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0D9RZP5_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASARREIGG
A0A0D9RJZ8_BCL2L1-      ----------------------------MSQSNRELVVD-----------
A0A0D9S017_BCL2-01      ----------------------MAHAGRTGYDNREIVMK-----------
A0A0D9RRC3_BCL2A1-      -----------------------MTDCEFGYIYR-LAQD-----------
A0A0D9RG38_BCL2L10      -----------------------MADPLRERTER-LLAD-----------
A0A0D9RU30_BCL2L2-      -----------------------MATPASAPDTRALVAD-----------
                                                         * :  .           

A0A0D9RZP5_MCL1-01      GEAGTVIGGSAGASPPAALTPDARRVARPPPIGAEVPDVTATPARLLFFA
A0A0D9RJZ8_BCL2L1-      ---------------------------------------------FLSYK
A0A0D9S017_BCL2-01      ---------------------------------------------YIHYK
A0A0D9RRC3_BCL2A1-      ---------------------------------------------YLQYV
A0A0D9RG38_BCL2L10      ---------------------------------------------YLG--
A0A0D9RU30_BCL2L2-      ---------------------------------------------FVGYK
                                                                      :   

A0A0D9RZP5_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGES
A0A0D9RJZ8_BCL2L1-      LSQKGYSWSQFSDVEENR-----------------------------TEA
A0A0D9S017_BCL2-01      LSQRGYEW--------DA-----------------------------GDV
A0A0D9RRC3_BCL2A1-      LQI-----------------------------------------------
A0A0D9RG38_BCL2L10      ------CC------------------------------------------
A0A0D9RU30_BCL2L2-      LRQKGYVC------------------------------------------
                                                                          

A0A0D9RZP5_MCL1-01      GNSSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMS
A0A0D9RJZ8_BCL2L1-      PEGTESEMETPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAA--
A0A0D9S017_BCL2-01      GAATPGAAPAPGIFSSQPG-HTPHPAASRDPVARTSPLPTPAAPAAAAGP
A0A0D9RRC3_BCL2A1-      --------PQPGSGPSKTS-------------------------------
A0A0D9RG38_BCL2L10      -------AREPGTPEPRPS-------------------------------
A0A0D9RU30_BCL2L2-      -------GAGPG--EGPAA-------------------------------
                                  *.                                      

A0A0D9RZP5_MCL1-01      RSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A0D9RJZ8_BCL2L1-      --------VKQTLREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVV
A0A0D9S017_BCL2-01      ALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV
A0A0D9RRC3_BCL2A1-      ------RVLQKVASSVQKEVEKNLKPCLDNVNV---ASIDTARTLFNQVM
A0A0D9RG38_BCL2L10      ------TPEAAVLRSAAARLRQLHRSFFSAYLG----YPGNRVELVALMA
A0A0D9RU30_BCL2L2-      ------DPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVS
                                   .   .   .       :                 .  : 

A0A0D9RZP5_MCL1-01      VHVFSDG-VTNWGRIVTLISFGAFVAKHLKTINQESC-------------
A0A0D9RJZ8_BCL2L1-      NELFRD--GVNWGRIVAFFSFGGALCVESVDKEMQVL-------------
A0A0D9S017_BCL2-01      EELFRD--GVNWGRIVAFFEFGGVMCVESVNREMSPL-------------
A0A0D9RRC3_BCL2A1-      EKEFEDG-IINWGRIVTIFAFEGILI-----------------KKLLRQR
A0A0D9RG38_BCL2L10      DAVLSDSPGPTWGRVVSLVTFAGTLL------EREPLMTAWWKKQSFQPR
A0A0D9RU30_BCL2L2-      DELFQG--GPNWGRLVAFFVFGAALCAESVNKEMEPL-------------
                           : .    .***:*::. * . :                         

A0A0D9RZP5_MCL1-01      ------IEPLAESITDVLVRTKRD----WLVKQRGWD-GFVEFFHVEDLE
A0A0D9RJZ8_BCL2L1-      ------VSRIAAWMATYLNDHLEP----WIQENGGWD-TFVELYGNNAAA
A0A0D9S017_BCL2-01      ------VDNIALWMTEYLNRHLHT----WIQDNGGWD-AFVELYGPSM--
A0A0D9RRC3_BCL2A1-      IAPDVDTYKEISYFVAEFITNNTGE---WIRQNGGWENGFVKKFEP----
A0A0D9RG38_BCL2L10      LEQEGDVARDCQRLVALLSSRLAGQHRAWLQAQGGWD-GFCHFFRS----
A0A0D9RU30_BCL2L2-      ------VGQVQEWMVAYLETRLAD----WIHSSGGWA-EFTALYGDGALE
                                     :.  :          *:  . **   *   :      

A0A0D9RZP5_MCL1-01      GGI-------------RNVLLAFAGVAGVGAGLAYLIR---
A0A0D9RJZ8_BCL2L1-      ESRKGQERFN------RWFLTGM-TVAGVVLLGSLFSRK--
A0A0D9S017_BCL2-01      -----RPLFDFSWLSLKTLLSLA-LVGACITLGAYLGHK--
A0A0D9RRC3_BCL2A1-      ---------KSGW---MTFLEVTGKICEMLSLLKQYC----
A0A0D9RG38_BCL2L10      ------PFPLAFW---RKLLIQAFLACLLATAFGYLWTRLL
A0A0D9RU30_BCL2L2-      EA---RRLREGNWASVRTVLTGAVALGALVTVGAFFASK--
                                          .*                     

© 1998-2019