Dataset for protein BCL-2-like of organism Cercocebus atys

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5MZX9_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKG------Y----VCGAGPGEGP-A
A0A2K5LXU8_MCL1-02      -------------------MFGLKRNAVIGLNLY----CGGAGLGAGSGG
A0A2K5LXU8_MCL1-01      -------------------MFGLKRNAVIGLNLY----CGGAGLGAGSGG
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      ------MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESE
A0A2K5NZS5_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEW--------DAGDVGAATPGV
A0A2K5KHH9_BCL2A1-      -MTDCEFGYIYR-LAQDYLQYVLQI----------------PQPGSGPSK
A0A2K5KHH9_BCL2A1-      -MTDCEFGYIYR-LAQDYLQYVLQI----------------PQPGSGPSK
A0A2K5KHH9_BCL2A1-      -MTDCEFGYIYR-LAQDYLQYVLQI----------------PQPGSGPSK
A0A2K5LXU8_MCL1-03      -------------MFGLKRNAVIGLNLY----------CGGAGLGAGSGG
A0A2K5MMZ4_BCL2L10      -MADPLRERTER-LLADYLG------------------CCAREPGTPEPR
A0A2K5MZX9_BCL2L2-      -MATPASAPDTRALVADFVGYKLRQKGY----------VCGAGPG--EGP
                                                                          

A0A2K5MZX9_BCL2L2-      ADP-----------------------------------------------
A0A2K5LXU8_MCL1-02      ATP-----------------------------------------------
A0A2K5LXU8_MCL1-01      ATP-----------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      METPSAINGNPSWHLVDSPAVNGATGHSSSLDAREVIPMAA---------
A0A2K5NZS5_BCL2-01      APAPGIFSSQPG-HTPHPAASRDPVARTSPLPTPAAPAAAAGPALSPVPP
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-03      ATPPGGRLLATGAKDTKPMGRSGATSRK----------------------
A0A2K5MMZ4_BCL2L10      PSTP----------------------------------------------
A0A2K5MZX9_BCL2L2-      AADP----------------------------------------------
                                                                          

A0A2K5MZX9_BCL2L2-      -LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQG
A0A2K5LXU8_MCL1-02      -PGGRLLATEKEASARREIGGGEAGTVIGGSA-GASPP------------
A0A2K5LXU8_MCL1-01      -PGGRLLATEKEASARREIGGGEAGTVIGGSA-GASPP------------
A0A2K5M8B1_BCL2L1-      ----MWKRTGLRPQKGLNRRWRPPVPSMATHP-GTAYQSFEQVVNELFRD
A0A2K5M8B1_BCL2L1-      -VKQALREAGDEFELRYRRAFSDLTSQLHITP-GTAYQSFEQVVNELFRD
A0A2K5NZS5_BCL2-01      VVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-FTARGRFATVVEELFRD
A0A2K5KHH9_BCL2A1-      -TSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFED
A0A2K5KHH9_BCL2A1-      -TSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFED
A0A2K5KHH9_BCL2A1-      -TSRVLQKVAFSVQKEVEKNLKPCLDNVNVASIDTARTLFNQVMEKEFED
A0A2K5LXU8_MCL1-03      -ALETLRRVGDGVQRNHETAFQGMLRKLDIKN-EDDVKSLSRVMVHVFSD
A0A2K5MMZ4_BCL2L10      -EAAVLRSAA----ARLRQLHRSFFSAYRGYR-GNRVELVALMAEAVLSD
A0A2K5MZX9_BCL2L2-      -LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQQRFTQVSDELFQG
                                .                                         

A0A2K5MZX9_BCL2L2-      G--PNWGRLVAFFVFGAALCA--------------ESVNKEMEPLVGQVQ
A0A2K5LXU8_MCL1-02      ----------------AALTP--------------DARRVARPPPIG---
A0A2K5LXU8_MCL1-01      ----------------AALTP--------------DARRVARPPPIG---
A0A2K5M8B1_BCL2L1-      G--VNWGRIVAFFSFGGALCV--------------ESVDKEMQVLVSRIA
A0A2K5M8B1_BCL2L1-      G--VNWGRIVAFFSFGGALCV--------------ESVDKEMQVLVSRIA
A0A2K5NZS5_BCL2-01      G--VNWGRIVAFFEFGGVMCV--------------ESVNREMSPLVDNIA
A0A2K5KHH9_BCL2A1-      G-IINWGRIVTIFAFEGILIK-----------KLLRQRIAPDVDTYKEIS
A0A2K5KHH9_BCL2A1-      G-IINWGRIVTIFAFEGILIK-----------KLLRQRIAPDVDTYKEIS
A0A2K5KHH9_BCL2A1-      G-IINWGRIVTIFAFEGILIK-----------KLLRQRIAPDVDTYKEIS
A0A2K5LXU8_MCL1-03      G-VTNWGRIVTLISFGAFVAK--------------HLKTINQESCIEPLA
A0A2K5MMZ4_BCL2L10      SPGPTWGRVVSLVTFAGTLLEREPLVTAWWKKRGFQPRLKEQEGDVARDC
A0A2K5MZX9_BCL2L2-      --GPNWGRLVAFFVFGAALCA--------------ESVNKEMEPLVGQVQ
                                        . :                               

A0A2K5MZX9_BCL2L2-      EWMVAYLETRLADWIHSSGGWELEAIKARVREMEE-EAEKLKELQNEVEK
A0A2K5LXU8_MCL1-02      --------AEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEE
A0A2K5LXU8_MCL1-01      --------AEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEE
A0A2K5M8B1_BCL2L1-      AWMATYLNDHLEP-------------------------------------
A0A2K5M8B1_BCL2L1-      AWMATYLNDHLEP-------------------------------------
A0A2K5NZS5_BCL2-01      LWMTEYLNRHLHT-------------------------------------
A0A2K5KHH9_BCL2A1-      YFVAEFIMNNTGE-------------------------------------
A0A2K5KHH9_BCL2A1-      YFVAEFIMNNTGE-------------------------------------
A0A2K5KHH9_BCL2A1-      YFVAEFIMNNTGE-------------------------------------
A0A2K5LXU8_MCL1-03      ESITDVLVRTKRD-------------------------------------
A0A2K5MMZ4_BCL2L10      QRLVALLSSRLAGQH-----------------------------------
A0A2K5MZX9_BCL2L2-      EWMVAYLETRLAD-------------------------------------
                                                                          

A0A2K5MZX9_BCL2L2-      QMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGC
A0A2K5LXU8_MCL1-02      LDGYEPEPLGKRPAVLPLLE---------LVGESGNSPSTD---------
A0A2K5LXU8_MCL1-01      LDGYEPEPLGKRPAVLPLLE---------LVGESGNSPSTD---------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5MZX9_BCL2L2-      GSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVI
A0A2K5LXU8_MCL1-02      -------------GSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAK
A0A2K5LXU8_MCL1-01      -------------GSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAK
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5MZX9_BCL2L2-      PKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRP-------
A0A2K5LXU8_MCL1-02      DTKPMGRSGATSRKALETLRRVGDGVQRNHETA--FQGWVCGV-------
A0A2K5LXU8_MCL1-01      DTKPMGRSGATSRKALETLRRVGDGVQRNHETA--FQGMLRKLDIKNEDD
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5MZX9_BCL2L2-      ----------------------------------------RGRVYRGRAR
A0A2K5LXU8_MCL1-02      ----------LPCRGPRRW---------------------HQKCAAGCCR
A0A2K5LXU8_MCL1-01      VKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAE
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5M8B1_BCL2L1-      --------------------------------------------------
A0A2K5NZS5_BCL2-01      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5KHH9_BCL2A1-      --------------------------------------------------
A0A2K5LXU8_MCL1-03      --------------------------------------------------
A0A2K5MMZ4_BCL2L10      --------------------------------------------------
A0A2K5MZX9_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5MZX9_BCL2L2-      A---------TSWYSPY---------------------------------
A0A2K5LXU8_MCL1-02      CCWS------RSWF------------------------------------
A0A2K5LXU8_MCL1-01      SITDVLVRTKRDWLVKQRGWDG-FVEFFHVEDLEGGI------------R
A0A2K5M8B1_BCL2L1-      ------------WIQENGGWDT-FVELYGNNAAAESRKGQERFNRW----
A0A2K5M8B1_BCL2L1-      ------------WIQENGGWDT-FVELYGNNAAAESRKGQERFN------
A0A2K5NZS5_BCL2-01      ------------WIQDNGGWDA-FVELYGPSM-------RPLFDFSWLSL
A0A2K5KHH9_BCL2A1-      ------------WIRQNGGWENGFVKKFEP-------------------K
A0A2K5KHH9_BCL2A1-      ------------WIRQNGGWENGFVKKLEP-------------------K
A0A2K5KHH9_BCL2A1-      ------------WIRQNGGWGK----------------------------
A0A2K5LXU8_MCL1-03      ------------WLVKQRGWDG-FVEFFHVEDLEGGI------------R
A0A2K5MMZ4_BCL2L10      ----------RAWLQAQGGWDG-FCHFFRS---------PFPLAFW---R
A0A2K5MZX9_BCL2L2-      ------------WIHSSGGWAE-FTALYGDGALEEAR--RLREGNWASVR
                                    *                                     

A0A2K5MZX9_BCL2L2-      --------------------------
A0A2K5LXU8_MCL1-02      ----------GISNKIALL-------
A0A2K5LXU8_MCL1-01      NVLLAVAGVAGVGAGLAYLIR-----
A0A2K5M8B1_BCL2L1-      --FLTGMTVAGVVLLGSLFSRK----
A0A2K5M8B1_BCL2L1-      RWFLTGMTVAGVVLLGSLFSRK----
A0A2K5NZS5_BCL2-01      KTLLSLALVGACITLGAYLGHK----
A0A2K5KHH9_BCL2A1-      SGWMTFLEVTGKICEMLSLLKQYC--
A0A2K5KHH9_BCL2A1-      SGWMTFLEVTGKICEMLSLLKQYC--
A0A2K5KHH9_BCL2A1-      --WHNHMPM---LVESVAHRKKKMAL
A0A2K5LXU8_MCL1-03      NVLLAVAGVAGVGAGLAYLIR-----
A0A2K5MMZ4_BCL2L10      TLLIQAFLACLLATAFGYLWTRLL--
A0A2K5MZX9_BCL2L2-      TVLTGAVALGALVTVGAFFASK----
                                                  

© 1998-2019