Dataset for protein BCL-2-like of organism Cavia porcellus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A286XUI2_BCL2A1-      MGHILLSATAGSLDLREPAAGCCLPPRMIDLEFRYTQALAQDYLLHVLQV
A0A286Y1M5_MCL1-01      -----------------------MSPEEELDGYEPEPLGKRPAVLPLLGL
A0A286Y5D6_BCL2L1-      ---------------------MSQSNWELVVDFLSYKLSQKGYSWSQFSD
A0A286XQQ9_BCL2L2-      ----------------MATPASAPDTRALVADFVGYKLRQKGYVC-----
H0W1T3_BCL2-01          ---------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEW-----
                                                        :       .         

A0A286XUI2_BCL2A1-      P-------------------------------------------------
A0A286Y1M5_MCL1-01      VGEAGKSPSADGSLPSTPPPAEEEEEEDALYRQSLEIISRYLREQAAGAK
A0A286Y5D6_BCL2L1-      V-EENRTEGPEGTESEMETPSAINGNPSWHLTDSPTVNGATGHSSSLDAR
A0A286XQQ9_BCL2L2-      -------GAGPG-------------------------------EGP----
H0W1T3_BCL2-01          -------DAGDGSALGRNSPLGVPRDPAARTSPPPPLAGLAVAQGP----
                                                                          

A0A286XUI2_BCL2A1-      ------QCETSPSKASKVLQDMALSVQEEVERRLKPWLDRIDVESIDTAK
A0A286Y1M5_MCL1-01      DSKPLGGVGPTSRKALETLRRVGDGVQRNHQTAFQGMLRKLDIKN-EDDV
A0A286Y5D6_BCL2L1-      EVIPMAAVK-------QALREAGDEFELRYRRAFSDLTSQLHITP-GTAY
A0A286XQQ9_BCL2L2-      ------AADP----LHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GSAQ
H0W1T3_BCL2-01          ------ALSPVPPVVHLTLRQAGDDFSRRYRQDFAEMSSQLHLTP-FTAR
                                         .:.  .  ..      :     .: :       

A0A286XUI2_BCL2A1-      SIFNQVMEKEFEDGIINWGRIVTIFAFGGVILKKLPREPIAPDVDTYKEI
A0A286Y1M5_MCL1-01      KSLSRVVALVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIE---PL
A0A286Y5D6_BCL2L1-      QSFEQVVNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVR---RI
A0A286XQQ9_BCL2L2-      QRFTQVSDELFQGGP-NWGRLVAFFVFGAALCAESVNKEMQPLVG---QV
H0W1T3_BCL2-01          GRFAT----LFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD---NI
                          :       * .*  ****:*::: **. :            :     :

A0A286XUI2_BCL2A1-      SYFVAEFIMSRMGGWIRQNGGW------------------DNGFVRKFEP
A0A286Y1M5_MCL1-01      AESITDALVHSKRDWLVKQRGWDGFVEFF----HIED---LEGGIRNVLL
A0A286Y5D6_BCL2L1-      ASWMATYLNDHLEPWIQDNGGWDTFVELYGNNAAAES---RKGQERFNRW
A0A286XQQ9_BCL2L2-      QEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRT
H0W1T3_BCL2-01          ALWMTEYLNRHLHTWIQDNGGW----------------------------
                           :.  :      *: .. **                            

A0A286XUI2_BCL2A1-      KSGWLTFVGVMGQLCEMLSLLKQFY
A0A286Y1M5_MCL1-01      AFAGVAGVGA----GLAYLIR----
A0A286Y5D6_BCL2L1-      LLTGVTVAGVVL-LGSLFSRK----
A0A286XQQ9_BCL2L2-      VLTGAVALGALVTVGAFFASK----
H0W1T3_BCL2-01          -------------VGACLSE-----
                                                 

© 1998-2019