Dataset for protein BCL-2-like of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452GAH0_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGG
A0A452GAH0_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATAR------
A0A452EK63_BCL2A1-      --------------------------------------------------
A0A452ECF0_BCL2L2-      --------------------------------------------------
A0A452E1B1_BCL2L1-      --------------------------------------------------
A0A452FWV3_BCL2L1-      --------------------------------------------------
A0A076FZV9_BCL2-01      --------------------------------------------------
A0A452EV13_BCL2-01      --------------------------------------------------
A0A076FU27_BCL2-01      --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
A0A452FIG6_BCL2L1-      --------------------------------------------------
                                                                          

A0A452GAH0_MCL1-01      EAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAP
A0A452GAH0_MCL1-02      ---------AGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAP
A0A452EK63_BCL2A1-      ----------------------------------MTDTEFDYVHKLAEDY
A0A452ECF0_BCL2L2-      ---------------------------------MATPASAPDTRALVADF
A0A452E1B1_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A452FWV3_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A076FZV9_BCL2-01      --------------------------------MAHAGGTGYDNREIVMKY
A0A452EV13_BCL2-01      --------------------------------MAHAGGTGYDNREIVMKY
A0A076FU27_BCL2-01      --------------------------------MAHAGGTGYDNREIVMKY
A0A452FIG6_BCL2L1-      --------------------------------------MSQSNRELVVDF
A0A452FIG6_BCL2L1-      --------------------------------------MSQSNRELVVDF
                                                                   . :    

A0A452GAH0_MCL1-01      TRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLALMVGEAS
A0A452GAH0_MCL1-02      TRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLALMVGEAS
A0A452EK63_BCL2A1-      LKYVLQ--------------------------------------------
A0A452ECF0_BCL2L2-      VGYKLRQKGY----------------------------------------
A0A452E1B1_BCL2L1-      LSYKFFQKGYSWSQFSDMEENRTETLEGTESDMETPSAISGNPSWHLADS
A0A452FWV3_BCL2L1-      LSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNPSWHLADS
A0A076FZV9_BCL2-01      IHYKLSQRGYEWD------------AGAAG---AAPPGAAPAPGILSSQP
A0A452EV13_BCL2-01      IHYKLSQRGYEWD------------AGAAG---AAPPGAAPAPGILSSQP
A0A076FU27_BCL2-01      IHYKLSQRGYEWD------------ARAAG---AAPPGAAPAPGILSSQP
A0A452FIG6_BCL2L1-      LSYKLSQKGFSWS------------LRRDKIRYGNPNAVNANPSWHLAHS
A0A452FIG6_BCL2L1-      LSYKLSQKGFSWS------------LRRDKIRYGNPNAVNANPSWHLAHS
                                                                          

A0A452GAH0_MCL1-01      NNSPGSDGSLPSTPPPSEEEEDELYRQSLEIISQYLLEQATGAKDAKPLG
A0A452GAH0_MCL1-02      NNSPGSDGSLPSTPPPSEEEEDELYRQSLEIISQYLLEQATGAKDAKPLG
A0A452EK63_BCL2A1-      ---------------IQQPGS-----------------------------
A0A452ECF0_BCL2L2-      ---------------VCGAGP-----------------------------
A0A452E1B1_BCL2L1-      SVVNGATGHSRSLDAGKMIPT-----------------------------
A0A452FWV3_BCL2L1-      PAVNGATGHSRSLDAREVIPM-----------------------------
A0A076FZV9_BCL2-01      GRTPAPSRTSPPPPPAAAAGP-----------------------------
A0A452EV13_BCL2-01      GRAPAPSRTSPPPPPAAAAGP-----------------------------
A0A076FU27_BCL2-01      GRTPAPSRTSPPPPPAAAAGP-----------------------------
A0A452FIG6_BCL2L1-      PAVNGATGHTEESGPVATAQQ-----------------------------
A0A452FIG6_BCL2L1-      PAVNGATGHTEESGPVATAQQ-----------------------------
                                                                          

A0A452GAH0_MCL1-01      GSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A452GAH0_MCL1-02      GSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A452EK63_BCL2A1-      KPSKTSRVLQDVASSVQDEVERTLKQCLDKFDV---VSVDTARTIFNQVM
A0A452ECF0_BCL2L2-      GEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVS
A0A452E1B1_BCL2L1-      AV------VKQALREASNECELRYQQTFSDLTSQLHITPGTTYQSFEQVI
A0A452FWV3_BCL2L1-      AA------VKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVV
A0A076FZV9_BCL2-01      APSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV
A0A452EV13_BCL2-01      APSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV
A0A076FU27_BCL2-01      APSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVV
A0A452FIG6_BCL2L1-      AP-----------REAGSEFELRHQQTVSDLTSQLHTTPGTAYQSFEQVM
A0A452FIG6_BCL2L1-      AP-----------REAGSEFELRHQQTVSDLTSQLHTTPGTAYQSFEQVM
                                       . .  .      .  :      .       :  * 

A0A452GAH0_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQES---CIEPLAESITDV
A0A452GAH0_MCL1-02      VHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQES---CIEPLAESITDV
A0A452EK63_BCL2A1-      EKEFEDGIVNWGRIVTIFAFEGILTKKLLSKRIASDMDMCKDISYFVAEF
A0A452ECF0_BCL2L2-      DELFQGG-PNWGRLVAFFVFGAALCAESVNKEMEP---LVGQVQEWMVAY
A0A452E1B1_BCL2L1-      NELFQDG-VNWCRNVAFFSFGGALCMKSIVKEMQV---LVSQVTTWMATY
A0A452FWV3_BCL2L1-      NELFRDG-VNWGRIVAFFSFGGALCVESVDKEMQV---LVSRIATWMATY
A0A076FZV9_BCL2-01      EELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSP---LVDSIALWMTEY
A0A452EV13_BCL2-01      EELFRDG-VNWGRIVAFFEFGGVMCVESVNREMSP---LVDSIALWMTEY
A0A076FU27_BCL2-01      EELFRDG-VNWGRIVAFFEFGGVICVESVNREMSP---LVDSIALWMTEY
A0A452FIG6_BCL2L1-      YELFWDG-VNWDHTVAFFSFRGALCMESVDKEMQV---LVSQVMTWMASQ
A0A452FIG6_BCL2L1-      YELFWDG-VNWDHTVAFFSFRGALCMESVDKEMQV---LVSQVMTWMASQ
                           * .*  ** . *::: * . :                  :   :.  

A0A452GAH0_MCL1-01      LVRSKRDWIVKQRGWDG-FVEFFHVEDLEGG-------------------
A0A452GAH0_MCL1-02      LVRSKRDWIVKQRGWDG-FVEFFHVEDLEGG-------------------
A0A452EK63_BCL2A1-      ITENTGEWIRQNGGWENGFVKKFETK------------------------
A0A452ECF0_BCL2L2-      LETRLADWIHSSGGWAE-FTALYGDGALEEARRLRE--------------
A0A452E1B1_BCL2L1-      LNNHLEPWIQENGDWDI-FVELYENNTATESQKGQEHFNRWSLTDVT---
A0A452FWV3_BCL2L1-      LNDHLEPWIQENGGWDT-FVELYGNNAAAESRKGQERFNRWFLTGMT---
A0A076FZV9_BCL2-01      LNRHLHAWIQDNGGWDA-FVELY---------------------------
A0A452EV13_BCL2-01      LNRHLHAWIQDNGGWDA-FVELY---------------------------
A0A076FU27_BCL2-01      LNRHLHAWIQDNGGWDA-FVELY---------------------------
A0A452FIG6_BCL2L1-      LNDHLEPWIQENGGWDT-SVEFCENNTATESQKGQERFNCWSLTAVTLAG
A0A452FIG6_BCL2L1-      LNDHLEPWIQENGGWDT-SVEFCENNTATESQKGQERFNCWSLTAVTLA-
                        :      ** .. .*    .                              

A0A452GAH0_MCL1-01      ---------------------IRNVLLAFAGVAGVGAGLAYLIR
A0A452GAH0_MCL1-02      ---------------------IRNVLLAFAGVAGVGAGLAYLIR
A0A452EK63_BCL2A1-      -------------SGWLTFLEVTGKI--CETLCRLKQYY-----
A0A452ECF0_BCL2L2-      -------------GNWASVRTVLTGAVALGALVTVGAFFASK--
A0A452E1B1_BCL2L1-      ----------------------------VAGMALLGLLFNT---
A0A452FWV3_BCL2L1-      ----------------------------VAGVVLLGSLFSRK--
A0A076FZV9_BCL2-01      --GPSMRPLFD--FSWLSLKALLSLAL-VGACITLGAYLGHK--
A0A452EV13_BCL2-01      --GPSMRPLFD--FSWLSLKALLSLAL-VGACITLGAYLGHK--
A0A076FU27_BCL2-01      --GPSMRPLFD--FSWLSLKALLSLAL-VGACITLGAYLGHK--
A0A452FIG6_BCL2L1-      GSGLSRKAAVSKDTPWLT----------FPSPHAQAY-------
A0A452FIG6_BCL2L1-      --GLALQLIVT--VPFITVIHVLHKLV-FPS-FCYSYRDLTI--
                                                                    

© 1998-2019