Dataset for protein Bcl-xL of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A452FIG6_BCL2L1-      MSQSNRELVVDFLSYKLSQKGFSWSLRRD------------KIRYGNPNA
A0A452FIG6_BCL2L1-      MSQSNRELVVDFLSYKLSQKGFSWSLRRD------------KIRYGNPNA
A0A452E1B1_BCL2L1-      MSQSNRELVVDFLSYKFFQKGYSWSQFSDMEENRTETLEGTESDMETPSA
A0A452FWV3_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSA
                        ****************: ***:***   *            :    .*.*

A0A452FIG6_BCL2L1-      VNANPSWHLAHSPAVNGATGHTEESG-----PVATAQQAPREAGSEFELR
A0A452FIG6_BCL2L1-      VNANPSWHLAHSPAVNGATGHTEESG-----PVATAQQAPREAGSEFELR
A0A452E1B1_BCL2L1-      ISGNPSWHLADSSVVNGATGHSRSLDAGKMIPTAVVKQALREASNECELR
A0A452FWV3_BCL2L1-      INGNPSWHLADSPAVNGATGHSRSLDAREVIPMAAVKQALREAGDEFELR
                        :..******* *..*******: . .     * *..:** ***..* ***

A0A452FIG6_BCL2L1-      HQQTVSDLTSQLHTTPGTAYQSFEQVMYELFWDGVNWDHTVAFFSFRGAL
A0A452FIG6_BCL2L1-      HQQTVSDLTSQLHTTPGTAYQSFEQVMYELFWDGVNWDHTVAFFSFRGAL
A0A452E1B1_BCL2L1-      YQQTFSDLTSQLHITPGTTYQSFEQVINELFQDGVNWCRNVAFFSFGGAL
A0A452FWV3_BCL2L1-      YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
                        :..:.******** ****:*******: ***.***** . ****** ***

A0A452FIG6_BCL2L1-      CMESVDKEMQVLVSQVMTWMASQLNDHLEPWIQENGGWDTSVEFCENNTA
A0A452FIG6_BCL2L1-      CMESVDKEMQVLVSQVMTWMASQLNDHLEPWIQENGGWDTSVEFCENNTA
A0A452E1B1_BCL2L1-      CMKSIVKEMQVLVSQVTTWMATYLNNHLEPWIQENGDWDIFVELYENNTA
A0A452FWV3_BCL2L1-      CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
                        *::*: ********.: ****: **:**********.**  **:  **:*

A0A452FIG6_BCL2L1-      TESQKGQERFNCWSLTAVTLAGGSGLSRKAAVSKDTPWLT---------F
A0A452FIG6_BCL2L1-      TESQKGQERFNCWSLTAVTLA---GLALQLIVT--VPFITVIHVLHKLVF
A0A452E1B1_BCL2L1-      TESQKGQEHFNRWSLTDVTVAGMALLGLLFNT------------------
A0A452FWV3_BCL2L1-      AESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK-----------------
                        :**.****.** * ** :*:*    *.                       

A0A452FIG6_BCL2L1-      PSPHAQAY-----
A0A452FIG6_BCL2L1-      PS-FCYSYRDLTI
A0A452E1B1_BCL2L1-      -------------
A0A452FWV3_BCL2L1-      -------------
                                     

© 1998-2019