Dataset for protein Bcl-2 of organism Capra hircus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A076FZV9_BCL2-01      MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGAAGAAPPGAAPAPGILS
A0A452EV13_BCL2-01      MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGAAGAAPPGAAPAPGILS
A0A076FU27_BCL2-01      MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDARAAGAAPPGAAPAPGILS
                        ******************************** *****************

A0A076FZV9_BCL2-01      SQPGRTPAPSRTSPPPPPAAAAGPAPSPVPPVVHLTLRQAGDDFSRRYRR
A0A452EV13_BCL2-01      SQPGRAPAPSRTSPPPPPAAAAGPAPSPVPPVVHLTLRQAGDDFSRRYRR
A0A076FU27_BCL2-01      SQPGRTPAPSRTSPPPPPAAAAGPAPSPVPPVVHLTLRQAGDDFSRRYRR
                        *****:********************************************

A0A076FZV9_BCL2-01      DFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
A0A452EV13_BCL2-01      DFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVE
A0A076FU27_BCL2-01      DFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVICVE
                        **********************************************:***

A0A076FZV9_BCL2-01      SVNREMSPLVDSIALWMTEYLNRHLHAWIQDNGGWDAFVELYGPSMRPLF
A0A452EV13_BCL2-01      SVNREMSPLVDSIALWMTEYLNRHLHAWIQDNGGWDAFVELYGPSMRPLF
A0A076FU27_BCL2-01      SVNREMSPLVDSIALWMTEYLNRHLHAWIQDNGGWDAFVELYGPSMRPLF
                        **************************************************

A0A076FZV9_BCL2-01      DFSWLSLKALLSLALVGACITLGAYLGHK
A0A452EV13_BCL2-01      DFSWLSLKALLSLALVGACITLGAYLGHK
A0A076FU27_BCL2-01      DFSWLSLKALLSLALVGACITLGAYLGHK
                        *****************************

© 1998-2019