Dataset for protein Mcl-1 of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


J9PBC4_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLASGKEATTRREGGGGEAGAVIGGS
J9PBC4_MCL1-02      MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLASGKEATTRREGGGGEAGAVIGGS
Q8HYS5_MCL1-01      MFGLKRNAVIRTQLYCGGAGLGAGSGGASSSGGRLLASGREATTRREGGGGEAGAVIGGS
                    **********  :**************************.********************

J9PBC4_MCL1-01      AGASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGPAADAIM
J9PBC4_MCL1-02      AGASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGPAADAIM
Q8HYS5_MCL1-01      AGASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLAPPCRASPPEEMEGPAADAIM
                    ************************************************************

J9PBC4_MCL1-01      SPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMDGSLPSTPPPAEEEEDELYRQSLE
J9PBC4_MCL1-02      SPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMDGSLPSTPPPAEEEEDELYRQSLE
Q8HYS5_MCL1-01      SPEEELDGYEPEPLGKRPAVLPLLELVGEASSGPGMDGSLPSTPPPAEEEEDELYRQSLE
                    ************************************************************

J9PBC4_MCL1-01      IISRYLREQATGAKDAKPLGGSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
J9PBC4_MCL1-02      IISRYLREQATGAKDAKPLGGSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
Q8HYS5_MCL1-01      IISRYLREQATGAKDAKPLGGSRAASRKALETLQRVGDGVQRNHETAFQGMLRKLDIKNE
                    *********************************.**************************

J9PBC4_MCL1-01      DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
J9PBC4_MCL1-02      DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
Q8HYS5_MCL1-01      DDVKSLSRVIVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
                    ************************************************************

J9PBC4_MCL1-01      TKRDWLVKQRGWDGGVWGEWSTPSDLKGESRKECCPSWAAEAGRWGADLSLQTVAQWLSP
J9PBC4_MCL1-02      TKRDWLVKQRGWDG--FVEFFHVEDLEGGIRN----------------------------
Q8HYS5_MCL1-01      TKRDWLVKQRGWDG--FVEFFHVEDLEGGIRN----------------------------
                    **************  : *:   .**:*  *:                            

J9PBC4_MCL1-01      LLSACRNSSAPPSSPLGIVYRTAWATQHTLFLKMILIWFALLPPRGPRWPREAWVTTCGT
J9PBC4_MCL1-02      ----------------------------------VLLAFAGV------------------
Q8HYS5_MCL1-01      ----------------------------------VLLAFAGV------------------
                                                      :*: ** :                  

J9PBC4_MCL1-01      PTPRSGPEAPWEFLSLPATQLFLPFLTKLLLEHSGISAGLKHFVAKR
J9PBC4_MCL1-02      ---------------------------------AGVGAGLAYLIR--
Q8HYS5_MCL1-01      ---------------------------------AGVGAGLAYLIR--
                                                     :*:.*** :::   

© 1998-2019