Dataset for protein BCL-2-like of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


J9PBC4_MCL1-01        MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLASGKEATTRREGGG
J9PBC4_MCL1-02        MFGLKRNAVIGLNLYCGGAGLGAGSGGASSSGGRLLASGKEATTRREGGG
Q8HYS5_MCL1-01        MFGLKRNAVIRTQLYCGGAGLGAGSGGASSSGGRLLASGREATTRREGGG
E2RS00_BCL2A1-01      -----------------------------------------MTDCEFGYT
Q45T69_BCL2L2-01      ----------------------MATPASAPDTRALVADFVGYKLRQKGYV
Q76LT7_BCL2L1-01      ---------------------------MSQSNRELVVDFLSYKLSQKGYS
J9NXG3_BCL2-02        ---------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYE
Q6R755_BCL2-01        ---------------------MAQAGRTGYDNREIVMKYIHYKLSQRGYE
J9NXG3_BCL2-01        ------------------------------------MKYIHYKLSQRGYE
Q75SV7_BCL2-01        ---------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYE
                                                                .    *  

J9PBC4_MCL1-01        GEAGAVIGGSAGASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLA
J9PBC4_MCL1-02        GEAGAVIGGSAGASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLA
Q8HYS5_MCL1-01        GEAGAVIGGSAGASPPTTLAPDARRVARPSPIGAEGPNVSATPPRLLLLA
E2RS00_BCL2A1-01      LALAQDYVRHVLQIP---------------------------QPG-----
Q45T69_BCL2L2-01      ----------CGAGP---------------------------GEG-----
Q76LT7_BCL2L1-01      WSQFSDVEENRTEAP---------------------------EGTESEME
J9NXG3_BCL2-02        WDAGEAGAAPPGAAP---------------------------APGISASX
Q6R755_BCL2-01        WDVGDVDAAPLGAAP---------------------------TPGIFSFQ
J9NXG3_BCL2-01        WDAGEAGAAPPGAAP---------------------------APGISASQ
Q75SV7_BCL2-01        WDAGEAGAAPPGAAP---------------------------APGIFSSQ
                                    *                                   

J9PBC4_MCL1-01        PPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
J9PBC4_MCL1-02        PPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
Q8HYS5_MCL1-01        PPCRASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEA
E2RS00_BCL2A1-01      -----------------------------------PAPSRASR-------
Q45T69_BCL2L2-01      -----------------------------------PAADPLHQ-------
Q76LT7_BCL2L1-01      TPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ--------
J9NXG3_BCL2-02        ----------------------------------SPVPPVVHL-------
Q6R755_BCL2-01        PESNPTPAVHR---DMAARTSPLRPIVATTGPTLSPVPPVVHL-------
J9NXG3_BCL2-01        XXXXXXXXXXX------XXXXXXXXXXXXXXXXXSPVPPVVHL-------
Q75SV7_BCL2-01        PGRAPAPARTSPPPPPAAPAAAAAAAADAAGPAPSPVPPVVHL-------
                                                           .            

J9PBC4_MCL1-01        SSGPGMDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLG
J9PBC4_MCL1-02        SSGPGMDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLG
Q8HYS5_MCL1-01        SSGPGMDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLG
E2RS00_BCL2A1-01      --------------------------------------------------
Q45T69_BCL2L2-01      --------------------------------------------------
Q76LT7_BCL2L1-01      --------------------------------------------------
J9NXG3_BCL2-02        --------------------------------------------------
Q6R755_BCL2-01        --------------------------------------------------
J9NXG3_BCL2-01        --------------------------------------------------
Q75SV7_BCL2-01        --------------------------------------------------
                                                                        

J9PBC4_MCL1-01        GSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE-DDVKSLSRV
J9PBC4_MCL1-02        GSRAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE-DDVKSLSRV
Q8HYS5_MCL1-01        GSRAASRKALETLQRVGDGVQRNHETAFQGMLRKLDIKNE-DDVKSLSRV
E2RS00_BCL2A1-01      -----------VLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTARTIFNQV
Q45T69_BCL2L2-01      -----------AMRAAGDEFETRFRRTFSDLAAQLHVTPG-SAQQRFTQV
Q76LT7_BCL2L1-01      -----------ALREAGDEFELRYRRAFSDLTSQLHITPG-TAYQSFEQV
J9NXG3_BCL2-02        -----------TLRQAGDDFSRRYRR-FAEMSSQLHLTPF-TARGRFATV
Q6R755_BCL2-01        -----------TLRRAGDDFSRRYRRDFAEMSSQLHLTPF-TARGRFATV
J9NXG3_BCL2-01        -----------TLRQAGDDFSRRYRR-FAEMSSQLHLTPF-TARGRFATV
Q75SV7_BCL2-01        -----------TLRQAGDDFSRRYRRDFAEMSSQLHLTPF-TARGRFATV
                                 .:. ..  .. .    :     .: :         :  *

J9PBC4_MCL1-01        IVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIE--PLAESITDV
J9PBC4_MCL1-02        IVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIE--PLAESITDV
Q8HYS5_MCL1-01        IVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIE--PLAESITDV
E2RS00_BCL2A1-01      MEKEFEDGVINWGRIVTVFAFEGILTKKLLEQRISSDVDAEKVSYFVAEF
Q45T69_BCL2L2-01      SDELFQGGP-NWGRLVAFFVFGAALCAESVNKEMEPLVG--QVQEWMVAY
Q76LT7_BCL2L1-01      VNELFRDGV-NWGRIVAFFSFGGALCVESVDKEMQVLVS--RIAAWMATY
J9NXG3_BCL2-02        VEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--NIALWMTEY
Q6R755_BCL2-01        VEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--NIALWMTEY
J9NXG3_BCL2-01        VEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--NIALWMTEY
Q75SV7_BCL2-01        VEELFRDGV-NWGRIVAFFEFGGVMCVESVNREMSPLVD--NIALWMTEY
                          * .*  ****:*:.: * . :     .   .  :    :   :.  

J9PBC4_MCL1-01        LVRTKRDWLVKQRGWDGGVWGEWSTPSDLKGESRKECCPSWAAEAGRWGA
J9PBC4_MCL1-02        LVRTKRDWLVKQRGWDG--FVEFFHVEDLEGGIRN---------------
Q8HYS5_MCL1-01        LVRTKRDWLVKQRGWDG--FVEFFHVEDLEGGIRN---------------
E2RS00_BCL2A1-01      ITRNMRDWIRQNGGWENG-FVKKFEPKS----------------------
Q45T69_BCL2L2-01      LETRLADWIHSSGGWAE--FTALYGDGALEEA---RRLREGNWASVR---
Q76LT7_BCL2L1-01      LNDHLEPWIQENGGWDT--FVELYGNNAAAESRKGQERFN------R---
J9NXG3_BCL2-02        LNRHLHTWIQDNGGW-----------------------------------
Q6R755_BCL2-01        LNRHLHTWIQDNGGWDA--FVELYGPTM-------QPLFDFSWLSLK---
J9NXG3_BCL2-01        LNRHLHTWIQDNGGWDA--FVELYGPTM-------QPLFDFSWLSLK---
Q75SV7_BCL2-01        LNRHLHTWIQDNGGWDA--FVELYGPTM-------QPLFDFSWLSLK---
                      :      *: .. **                                   

J9PBC4_MCL1-01        DLSLQTVAQWLSPLLSACRNSSAPPSSPLGIVYRTAWATQHTLFLKMILI
J9PBC4_MCL1-02        -----------------------------------------------VLL
Q8HYS5_MCL1-01        -----------------------------------------------VLL
E2RS00_BCL2A1-01      -----------------------------------------------GWL
Q45T69_BCL2L2-01      -----------------------------------------------TVL
Q76LT7_BCL2L1-01      -----------------------------------------------WFL
J9NXG3_BCL2-02        --------------------------------------------------
Q6R755_BCL2-01        -----------------------------------------------ALL
J9NXG3_BCL2-01        -----------------------------------------------ALL
Q75SV7_BCL2-01        -----------------------------------------------ALL
                                                                        

J9PBC4_MCL1-01        WFALLPPRGPRWPREAWVTTCGTPTPRSGPEAPWEFLSLPATQLFLPFLT
J9PBC4_MCL1-02        AFAGV---------------------------------------------
Q8HYS5_MCL1-01        AFAGV---------------------------------------------
E2RS00_BCL2A1-01      TFLEV---------------------------------------------
Q45T69_BCL2L2-01      TGAVA---------------------------------------------
Q76LT7_BCL2L1-01      TGMT----------------------------------------------
J9NXG3_BCL2-02        --------------------------------------------------
Q6R755_BCL2-01        SLAL----------------------------------------------
J9NXG3_BCL2-01        SLAL----------------------------------------------
Q75SV7_BCL2-01        SLAL----------------------------------------------
                                                                        

J9PBC4_MCL1-01        KLLLEHSGISAGLKHFVAKR-
J9PBC4_MCL1-02        ------AGVGAGLAYLIR---
Q8HYS5_MCL1-01        ------AGVGAGLAYLIR---
E2RS00_BCL2A1-01      ------LGTVCEMWSHLKQYY
Q45T69_BCL2L2-01      ------LGALVTVGAFFASK-
Q76LT7_BCL2L1-01      ------VAGVVLLGSLFSRK-
J9NXG3_BCL2-02        ---------------------
Q6R755_BCL2-01        ------VGACITLGAYLGHK-
J9NXG3_BCL2-01        ------VGACITLGAYLGHK-
Q75SV7_BCL2-01        ------VGACITLGAYLGHK-
                                           

© 1998-2019