Dataset for protein Bfl1 of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E2RS00_BCL2A1-01      MTQPGTRFWRGSEHSIRADSAKAKVPYVISVPGWEARLRDPEGSTRPPPG
E2RS00_BCL2A1-02      ----MSHLFGGSYDAQRCSGER-RLPAVGFMFLW----------------
                           :.:: **  : *... . .:* *  :  *                

E2RS00_BCL2A1-01      PQGLPGTLMTNVSIGKERKKDWRFSLFLPGRLADPEGTAGWGWQQNPQDL
E2RS00_BCL2A1-02      --------------------------------------------------
                                                                        

E2RS00_BCL2A1-01      PAQRFRKVNTQIFQRRSKVEQGPRLPDFRPGVTGQPTRRRSAWKPSAGPW
E2RS00_BCL2A1-02      --------------------------------------------------
                                                                        

E2RS00_BCL2A1-01      ESGRSKPTPESDEEEGAGPVVHTEIPPASTCRPESHPEPRQPRPHRASGS
E2RS00_BCL2A1-02      ------PTPESDEEEGAGPVVHTEIPPASTCRPESHPEPRQPRPHRASGS
                            ********************************************

E2RS00_BCL2A1-01      SRGTRLPSRRAGGPRMTDCEFGYTLALAQDYVRHVLQIPQPGPAPSRASR
E2RS00_BCL2A1-02      SRGTRLPSRRAGGPRMTDCEFGYTLALAQDYVRHVLQIPQPGPAPSRASR
                      **************************************************

E2RS00_BCL2A1-01      VLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTARTIFNQVMEKEFEDGVIN
E2RS00_BCL2A1-02      VLQDVAFSVQGQVEKNLKPCLDSFDVVSVDTARTIFNQVMEKEFEDGVIN
                      **************************************************

E2RS00_BCL2A1-01      WGRIVTVFAFEGILTKKLLEQRISSDVDAEKVSYFVAEFITRNMRDWIRQ
E2RS00_BCL2A1-02      WGRIVTVFAFEGILTKKLLEQRISSDVDAEKVSYFVAEFITRNMRDWIRQ
                      **************************************************

E2RS00_BCL2A1-01      NGGWENGFVKKFEPKSGWLTFLEVLGTVCEMWSHLKQYY
E2RS00_BCL2A1-02      NGGWENGFVKKFEPKSGWLTFLEVLGTVCEMWSHLKQYY
                      ***************************************

© 1998-2019