Dataset for protein Bcl-2 of organism Canis lupus familiaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


J9NXG3_BCL2-02      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGISASX--------
Q6R755_BCL2-01      MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDVGDVDAAPLGAAPTPGIFSFQPESNPTPA
J9NXG3_BCL2-01      ---------------MKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGISASQXXXXXXXX
Q75SV7_BCL2-01      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGEAGAAPPGAAPAPGIFSSQPGRAPAPA
                                   ****************.*:..*** ****:*** :          

J9NXG3_BCL2-02      --------------------------SPVPPVVHLTLRQAGDDFSRRYRR-FAEMSSQLH
Q6R755_BCL2-01      VHR---DMAARTSPLRPIVATTGPTLSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLH
J9NXG3_BCL2-01      XXX------XXXXXXXXXXXXXXXXXSPVPPVVHLTLRQAGDDFSRRYRR-FAEMSSQLH
Q75SV7_BCL2-01      RTSPPPPPAAPAAAAAAAADAAGPAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLH
                                              ************.*********** *********

J9NXG3_BCL2-02      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
Q6R755_BCL2-01      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
J9NXG3_BCL2-01      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
Q75SV7_BCL2-01      LTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEY
                    ************************************************************

J9NXG3_BCL2-02      LNRHLHTWIQDNGGW--------------------------------------------
Q6R755_BCL2-01      LNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
J9NXG3_BCL2-01      LNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
Q75SV7_BCL2-01      LNRHLHTWIQDNGGWDAFVELYGPTMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
                    ***************                                            

© 1998-2019