Dataset for protein Mcl-1 of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F7GTF7_MCL1-03      MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLL------------------------
F7GTF7_MCL1-02      MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGGGEAGAVTGGS
F7GTF7_MCL1-01      MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGGGEAGAVTGGS
                    ************************************                        

F7GTF7_MCL1-03      ------------------------------------------------------------
F7GTF7_MCL1-02      AGASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIM
F7GTF7_MCL1-01      AGASPPAALTPDARRVVRPPPIGAEVPDVTATPSRLLFFAPTRRAAPLEEMEAPAADAIM
                                                                                

F7GTF7_MCL1-03      ------------------------------------------------------------
F7GTF7_MCL1-02      SPEEELDGYEPEPLGKRPAVLPLLELVGEPANGSSTDGSLPSTPPPAEEEEDELYRQSLE
F7GTF7_MCL1-01      SPEEELDGYEPEPLGKRPAVLPLLELVGEPANGSSTDGSLPSTPPPAEEEEDELYRQSLE
                                                                                

F7GTF7_MCL1-03      ---------ATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
F7GTF7_MCL1-02      IISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
F7GTF7_MCL1-01      IISRYLREQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGWVCGV-----
                             ***************************************** :  :     

F7GTF7_MCL1-03      DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
F7GTF7_MCL1-02      DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
F7GTF7_MCL1-01      ------------LPCRGPRRW---------------------HQKCAAGFCGCC------
                                : . *  .*                     ::.*   :. .       

F7GTF7_MCL1-03      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
F7GTF7_MCL1-02      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
F7GTF7_MCL1-01      ----W---SRSWVGISNKIALE----------------------------
                        *   .*.* *: : : :*                            

© 1998-2019