Dataset for protein BCL-2-like of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


U3DBA0_BCL2A1-02        ----------------------MTDSEFGYIHNLTQDYLQYVLQI-----
U3DBA0_BCL2A1-01        ----------------------MTDSEFGYIHNLTQDYLQYVLQI-----
A0A2R8M4C0_BCL2L2-      ---------------------MATPASAPDTRALVADFVGYKLRQKGYV-
F7GTF7_MCL1-02          -----------------------------MFGLQRNAVIGLNLYCGG---
F7GTF7_MCL1-01          -----------------------------MFGLQRNAVIGLNLYCGG---
F7GTF7_MCL1-03          --------------------------MFGLQRNAVIGLNLY---------
F7IT34_BCL2L1-01        --------------------------MSQSNRELVVDFLSYKLSQKGYSW
F7IT34_BCL2L1-02        --------------------------MSQSNRELVVDFLSYKLSQKGYSW
A0A2R8MY14_BCL2-01      --------------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEW
A0A2R8M4C0_BCL2L2-      LLVLCPYINASLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYV-
F7CT87_BCL2L10-01       ----------------------MADPLRQRTEQLVTDYLEY---------
                                                                          

U3DBA0_BCL2A1-02        --------------------------------------------------
U3DBA0_BCL2A1-01        --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
F7GTF7_MCL1-02          --------------------------------------------------
F7GTF7_MCL1-01          --------------------------------------------------
F7GTF7_MCL1-03          --------------------------CGGAGLGAGSGGATPPGGRLLATG
F7IT34_BCL2L1-01        SQFSDVEENRTEAPEGTDSEMETPSAING-----NPSWHLADSPVVNGAT
F7IT34_BCL2L1-02        SQFSDVEENRTEAPEGTDSEMETPSAING-----NPSWHLADSPVVNGAT
A0A2R8MY14_BCL2-01      DA-GDVGAAPPGAAPAEGIFSSQPGHTPGPAAPRDPVARTSPPPPPAAPA
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
                                                                          

U3DBA0_BCL2A1-02        -------PQSGMGPSKTSRVLQQVAFSVQKEVEKSLKSCLDNVDIASIDN
U3DBA0_BCL2A1-01        -------PQSGMGPSKTSRVLQQVAFSVQKEVEKSLKSCLDNVDIASIDN
A0A2R8M4C0_BCL2L2-      ---CGTGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GS
F7GTF7_MCL1-02          ---AGLGAGSGGATPP------------GGRLLATEKEASAQREVGG-GE
F7GTF7_MCL1-01          ---AGLGAGSGGATPP------------GGRLLATEKEASAQREVGG-GE
F7GTF7_MCL1-03          AKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKN-ED
F7IT34_BCL2L1-01        GHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITP-GT
F7IT34_BCL2L1-02        GHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITP-GT
A0A2R8MY14_BCL2-01      AAATGPTLSPVPPV--VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTP-FT
A0A2R8M4C0_BCL2L2-      -CGTGPG--EGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTP-GS
F7CT87_BCL2L10-01       -CSREPGTPESPPSTAEAAVLRAVAASVRKLYRSFFSAYLG----YP-GN
                                                                          

U3DBA0_BCL2A1-02        ARTIFSQVMEKEFED--G-----------IINWGRIVTIFAFEGILIK--
U3DBA0_BCL2A1-01        ARTIFSQVMEKEFED--G-----------IINWGRIVTIFAFEGILIK--
A0A2R8M4C0_BCL2L2-      AQQRFTQVSDELFQG--G-----------P-NWGRLVAFFVFGAALCA--
F7GTF7_MCL1-02          AGA---------VTG--GSAGASPPAALTP-DARRVVRPPPIGAEV----
F7GTF7_MCL1-01          AGA---------VTG--GSAGASPPAALTP-DARRVVRPPPIGAEV----
F7GTF7_MCL1-03          DVKSLSRVMVHVFSD--G-----------VTNWGRIVTLISFGAFVAK--
F7IT34_BCL2L1-01        AYQSFEQVVNELFRD--G-----------V-NWGRIVAFFSFGGALCV--
F7IT34_BCL2L1-02        AYQSFEQVVNELFRD--G-----------V-NWGRIVAFFSFGGALCV--
A0A2R8MY14_BCL2-01      ARGRFATVVEELFRD--G-----------V-NWGRIVAFFEFGGVMCV--
A0A2R8M4C0_BCL2L2-      AQQRFTQVSDELFQG--G-----------P-NWGRLVAFFVFGAALCA--
F7CT87_BCL2L10-01       RVELVARMAEALLSDSPG-----------P-TWGNVVMLLAFAGTLLERG
                                    . .  *                .:*    : . :    

U3DBA0_BCL2A1-02        ------------KLLRERIAPDVDTYKEISHFVAEFIMNNTGE----WIR
U3DBA0_BCL2A1-01        ------------KLLRERIAPDVDTYKEISHFVAEFIMNNTGE----WIR
A0A2R8M4C0_BCL2L2-      ------------ESVNKEMEPLVG---QVQEWMVAYLETRLAD----WIH
F7GTF7_MCL1-02          --------------------PDVT---ATPSRLLFFAPTRRAA----PLE
F7GTF7_MCL1-01          --------------------PDVT---ATPSRLLFFAPTRRAA----PLE
F7GTF7_MCL1-03          ------------HLKTINQESCIE---PLAESITDVLVRTKRD----WLV
F7IT34_BCL2L1-01        ------------ESVDKEMQVLVS---RIAAWMATYLNDHLEP----WIQ
F7IT34_BCL2L1-02        ------------ESVDKEMQVLVS---RIAAWMATYLNDHLEP----WIQ
A0A2R8MY14_BCL2-01      ------------ESVNREMSPLVD---NIALWMTEYLNRHLHT----WIQ
A0A2R8M4C0_BCL2L2-      ------------ESVNKEMEPLVG---QVQEWMVAYLETRLAD----WIH
F7CT87_BCL2L10-01       PLVTARWKKWGFQSRLKEPEGDVA---RDCQRLVALLSSRLVGQHRAWLE
                                              :         :               : 

U3DBA0_BCL2A1-02        QNGGWGK-----------WHSLMLMLVSVAQKKRKMAL------------
U3DBA0_BCL2A1-01        QNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC----------
A0A2R8M4C0_BCL2L2-      SSGGWEL-EAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV--
F7GTF7_MCL1-02          EMEAPAA-DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPANGSSTDG
F7GTF7_MCL1-01          EMEAPAA-DAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPANGSSTDG
F7GTF7_MCL1-03          KQRGWDG-FVEFFHVEDLE-------GGIRNVLLAFAGVA----------
F7IT34_BCL2L1-01        ENGGWDT-FVELYGNNAAAESRK---GQERFNRWFLTGMT----------
F7IT34_BCL2L1-02        ENGGWDT-FVELYGNNAAAESRK---GQERFNRWFLTGMT----------
A0A2R8MY14_BCL2-01      DNGGWDA-FVELYGPSM----------RPLFDFSWLSLKT----------
A0A2R8M4C0_BCL2L2-      SSGGWAE-FTALYGDGALEEARRLREGNWASVRTVLTGAV----------
F7CT87_BCL2L10-01       AQGGWVS------KEGDTGRDRHLGTARPRWLLLLLQDLL----------
                           .                               :              

U3DBA0_BCL2A1-02        --------------------------------------------------
U3DBA0_BCL2A1-01        --------------------------------------------------
A0A2R8M4C0_BCL2L2-      -IMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKF
F7GTF7_MCL1-02          SLPSTPPPAEEEEDELYRQSLE----------------------IISRYL
F7GTF7_MCL1-01          SLPSTPPPAEEEEDELYRQSLE----------------------IISRYL
F7GTF7_MCL1-03          --------------------------------------------GVG---
F7IT34_BCL2L1-01        --------------------------------------------VAGVVL
F7IT34_BCL2L1-02        --------------------------------------------VAGVVL
A0A2R8MY14_BCL2-01      --------------------------------------------LLSLVL
A0A2R8M4C0_BCL2L2-      --------------------------------------------ALG---
F7CT87_BCL2L10-01       --------------------------------------------LAGIME
                                                                          

U3DBA0_BCL2A1-02        --------------------------------------------------
U3DBA0_BCL2A1-01        --------------------------------------------------
A0A2R8M4C0_BCL2L2-      SGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKIDFKAFIYSSLTQV-
F7GTF7_MCL1-02          REQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLD
F7GTF7_MCL1-01          REQATGAKDTKPMGRSGAASRKALETLRRVGDGVQRNHETAFQGWVCGV-
F7GTF7_MCL1-03          -----------------------------AGLAYLIR-------------
F7IT34_BCL2L1-01        -----------------------------LGSLFSRK-------------
F7IT34_BCL2L1-02        -----------------------------LGSLFSRK-------------
A0A2R8MY14_BCL2-01      VG-----------------------ACITLGAYLGHK-------------
A0A2R8M4C0_BCL2L2-      -------------------------ALVTVGAFFASK-------------
F7CT87_BCL2L10-01       KSAGPGFPVMVVNSSIHLLLDTIMRSFKSFSPLLPAQL------------
                                                                          

U3DBA0_BCL2A1-02        --------------------------------------------------
U3DBA0_BCL2A1-01        --------------------------------------------------
A0A2R8M4C0_BCL2L2-      -----IPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR
F7GTF7_MCL1-02          IKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESC
F7GTF7_MCL1-01          ----------------LPCRGPRRW---------------------HQKC
F7GTF7_MCL1-03          --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-02        --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
                                                                          

U3DBA0_BCL2A1-02        --------------------------------------------------
U3DBA0_BCL2A1-01        --------------------------------------------------
A0A2R8M4C0_BCL2L2-      GRVYRGRA-------------RATSWYSPY--------------------
F7GTF7_MCL1-02          IEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFA
F7GTF7_MCL1-01          AAGFCGCC----------W---SRSWVGISNKIALE--------------
F7GTF7_MCL1-03          --------------------------------------------------
F7IT34_BCL2L1-01        --------------------------------------------------
F7IT34_BCL2L1-02        --------------------------------------------------
A0A2R8MY14_BCL2-01      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      --------------------------------------------------
F7CT87_BCL2L10-01       --------------------------------------------------
                                                                          

U3DBA0_BCL2A1-02        --------------
U3DBA0_BCL2A1-01        --------------
A0A2R8M4C0_BCL2L2-      --------------
F7GTF7_MCL1-02          GVAGVGAGLAYLIR
F7GTF7_MCL1-01          --------------
F7GTF7_MCL1-03          --------------
F7IT34_BCL2L1-01        --------------
F7IT34_BCL2L1-02        --------------
A0A2R8MY14_BCL2-01      --------------
A0A2R8M4C0_BCL2L2-      --------------
F7CT87_BCL2L10-01       --------------
                                      

© 1998-2019