Dataset for protein Bcl-w of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2R8M4C0_BCL2L2-      LLVLCPYINASLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGYVC
A0A2R8M4C0_BCL2L2-      ---------------------MATPASAPDTRALVADFVGYKLRQKGYVC
                                             *****************************

A0A2R8M4C0_BCL2L2-      GTGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRF
A0A2R8M4C0_BCL2L2-      GTGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRF
                        **************************************************

A0A2R8M4C0_BCL2L2-      TQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAY
A0A2R8M4C0_BCL2L2-      TQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAY
                        **************************************************

A0A2R8M4C0_BCL2L2-      LETRLADWIHSSGGWA-EFTALYGDGALEEARRLRE--------------
A0A2R8M4C0_BCL2L2-      LETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPP
                        ***************  *          *** .*.*              

A0A2R8M4C0_BCL2L2-      -GNWASV------------RTVLTGAVALGALVT----------------
A0A2R8M4C0_BCL2L2-      PGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVT
                         ** ..*            *:: .* *  ** .                 

A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      ILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKIDFKAFIYS
                                                                          

A0A2R8M4C0_BCL2L2-      --------------------------------------------------
A0A2R8M4C0_BCL2L2-      SLTQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPR
                                                                          

A0A2R8M4C0_BCL2L2-      ---------VGAFFASK
A0A2R8M4C0_BCL2L2-      GRVYRGRARATSWYSPY
                                 . ::::. 

© 1998-2019