Dataset for protein Bfl1 of organism Callithrix jacchus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


U3DBA0_BCL2A1-02      MTDSEFGYIHNLTQDYLQYVLQIPQSGMGPSKTSRVLQQVAFSVQKEVEK
U3DBA0_BCL2A1-01      MTDSEFGYIHNLTQDYLQYVLQIPQSGMGPSKTSRVLQQVAFSVQKEVEK
                      **************************************************

U3DBA0_BCL2A1-02      SLKSCLDNVDIASIDNARTIFSQVMEKEFEDGIINWGRIVTIFAFEGILI
U3DBA0_BCL2A1-01      SLKSCLDNVDIASIDNARTIFSQVMEKEFEDGIINWGRIVTIFAFEGILI
                      **************************************************

U3DBA0_BCL2A1-02      KKLLRERIAPDVDTYKEISHFVAEFIMNNTGEWIRQNGGWGK--------
U3DBA0_BCL2A1-01      KKLLRERIAPDVDTYKEISHFVAEFIMNNTGEWIRQNGGWENGFVKKFEP
                      **************************************** :        

U3DBA0_BCL2A1-02      ---WHSLMLMLVSVAQKKRKMAL--
U3DBA0_BCL2A1-01      KSGWMTFLEVTGKICEMLSLLKQYC
                         * ::: :  .:.:    :    

© 1998-2019