Dataset for protein Mcl-1 of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A5PJR2_MCL1-01      MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGGEAGTVIGGSA
F1MQX4_MCL1-01      ------------------------------------------------------------
                                                                                

A5PJR2_MCL1-01      GPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMS
F1MQX4_MCL1-01      ------------------------------------------------------------
                                                                                

A5PJR2_MCL1-01      PEEELDGCEPDPLGKRPAVRPLPLLVGEASNNSPGSDGSLPSTPPPAEEEEDELYRQSLE
F1MQX4_MCL1-01      -------------------------------------GMLPIF---SEEEEDELYWQSLE
                                                         * **     :********.****

A5PJR2_MCL1-01      IISQYLREQATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
F1MQX4_MCL1-01      IISRYLREQATGAKDVKPLGGSGATSRKALETLHRVGDGVQHNHETAFQGMLQKLDIKNE
                    ***.***********.*******:*********.*******.**********.*******

A5PJR2_MCL1-01      DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVR
F1MQX4_MCL1-01      DDVKSLSRVMVHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQESCIEPLAESITDVLVR
                    **************** ********************:**********************

A5PJR2_MCL1-01      SKRDWIVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
F1MQX4_MCL1-01      SKRDWIVKERGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
                    ********:*****************************************

© 1998-2019