Dataset for protein BCL-2-like of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A5PJR2_MCL1-01          MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGG
Q3C2I0_BCL2A1-01        --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
                                                                          

A5PJR2_MCL1-01          EAGTVIGGSAGPSPPATLAPDARRVARPSPIGAEGPDVTATPTRLLFFAP
Q3C2I0_BCL2A1-01        --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
                                                                          

A5PJR2_MCL1-01          TRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEAS
Q3C2I0_BCL2A1-01        --------------------------------------------------
F1MV39_BCL2L10-01       --------------------------------------------------
Q05KI8_BCL2L2-01        --------------------------------------------------
Q1RMX3_BCL2L2-01        --------------------------------------------------
F1MQX4_MCL1-01          --------------------------------------------------
E1B9B3_BCL2L10-01       --------------------------------------------------
F6R2C4_BCL2-01          --------------------------------------------------
O02718_BCL2-01          --------------------------------------------------
Q05KJ0_BCL2L1-02        --------------------------------------------------
Q05KJ0_BCL2L1-01        --------------------------------------------------
A0A3Q1LRT3_BCL2L1-      --------------------------------------------------
                                                                          

A5PJR2_MCL1-01          NNSPGSDGSLPSTPPPAEEEEDELYRQSLEIISQYLREQATGA-------
Q3C2I0_BCL2A1-01        ---------------MTDTEFGYVHGLAEDYLKYVLQ-------------
F1MV39_BCL2L10-01       --------VADGQESLVERTARLL----MDYLEFCAREPGT---------
Q05KI8_BCL2L2-01        ----------MATPASAPDTRALV----ADFVGYKLRQKGY---------
Q1RMX3_BCL2L2-01        ----------MATPASAPDTRALV----ADFVGYKLRQKGY---------
F1MQX4_MCL1-01          ----------GMLPIFSEEEEDELYWQSLEIISRYLREQATGA-------
E1B9B3_BCL2L10-01       ---------MTEGGAMVDPFRERTARLLMDYLEFCAREPG----------
F6R2C4_BCL2-01          ---------MAHAGGTGYDNRE----IVMKYIHYKLSQRGYEW-------
O02718_BCL2-01          ---------MAHAGGTGYDNRE----IVMKYIHYKLSQRGYEW-------
Q05KJ0_BCL2L1-02        ---------------MSQSNRE----LVVDFLSYKLSQKGYSWSQFSDVE
Q05KJ0_BCL2L1-01        ---------------MSQSNRE----LVVDFLSYKLSQKGYSWSQFSDVE
A0A3Q1LRT3_BCL2L1-      ---------------MSQSNRE----LVVDFLSYKLSQKGYSWSQFS---
                                                     . :                  

A5PJR2_MCL1-01          -----------------------------------KDAKPLGGSGTTSRK
Q3C2I0_BCL2A1-01        ----------------------------------------IQQPGSKPSK
F1MV39_BCL2L10-01       ------------------------------------------PAPAPSTP
Q05KI8_BCL2L2-01        ----------------------------------------VCGAGPGEGP
Q1RMX3_BCL2L2-01        ----------------------------------------VCGAGPGEGP
F1MQX4_MCL1-01          -----------------------------------KDVKPLGGSGATSRK
E1B9B3_BCL2L10-01       -----------TPAPAPS----------TPEAAVLRHVAARIQEANRNVL
F6R2C4_BCL2-01          -DAGDAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPV
O02718_BCL2-01          -DAGDAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPV
Q05KJ0_BCL2L1-02        ENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREVI
Q05KJ0_BCL2L1-01        ENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREVI
A0A3Q1LRT3_BCL2L1-      -----------VRYGNPQWISGNPSWHLADSPTVNGATGHSRSLDARKMI
                                                                          

A5PJR2_MCL1-01          ALETLRR----VGDGVQRNHETAFQGMLRKLDIKNEDDVKS-LSRVMVHV
Q3C2I0_BCL2A1-01        TSRVLQD----VASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKE
F1MV39_BCL2L10-01       EAAVLRH--------VAARIQEANRNVLPLYRRCRRHRVEL-VARMAQRL
Q05KI8_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQVSDEL
Q1RMX3_BCL2L2-01        AADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQR-FTQVSDEL
F1MQX4_MCL1-01          ALETLHR----VGDGVQHNHETAFQGMLQKLDIKNEDDVKS-LSRVMVHV
E1B9B3_BCL2L10-01       P--------------LYRRCRRHRVELVARMA-----------QRLLDE-
F6R2C4_BCL2-01          P-PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGR-FATVVEEL
O02718_BCL2-01          P-PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARER-FATVVEEL
Q05KJ0_BCL2L1-02        PMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQVVNEL
Q05KJ0_BCL2L1-01        PMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQS-FEQVVNEL
A0A3Q1LRT3_BCL2L1-      PMTTVKQALREASNEFKLRYQQTFSDLMSQLRITPGTACQS-FEQVINEL
                                       .                             :    

A5PJR2_MCL1-01          F-SDGVTNWGRIVTLISFGAFVAK--------------HLKSINQESCIE
Q3C2I0_BCL2A1-01        F-EDGIVNWGRIVTIFAFEGILTK--------------KLLGKCIASDMD
F1MV39_BCL2L10-01       LDEDPGPSWGRVASLVTFAGSLLE--------------RPPQTTRRQKRD
Q05KI8_BCL2L2-01        F-QGG-PNWGRLVAFFVFGAALCA--------------ESVNKEMEPLVG
Q1RMX3_BCL2L2-01        F-QGG-PNWGRLVAFFVFGAALCA--------------ESVNKEMEPLVG
F1MQX4_MCL1-01          F-SDRVTNWGRIVTLISFGAFVAK--------------HFKSINQESCIE
E1B9B3_BCL2L10-01       --DPG-PSWGRVASLVTFAGSLLERPPQTTRRQEKRDDDGVSRDCRLLV-
F6R2C4_BCL2-01          F-RDG-VNWGRIVAFFEFGGVMCV--------------ESVNREMSPLVD
O02718_BCL2-01          F-RDG-VNWGRIVAFFEFGGVMCV--------------ESVNREMSPLVD
Q05KJ0_BCL2L1-02        F-RDG-VNWGRIVAFFSFGGALCV--------------ESVDKEMQVLVS
Q05KJ0_BCL2L1-01        F-RDG-VNWGRIVAFFSFGGALCV--------------ESVDKEMQVLVS
A0A3Q1LRT3_BCL2L1-      F-RDR-VKWGHVVAFFSFSGTLCM--------------KSIDKEIHVLVS
                               .**.:.::. * . :                            

A5PJR2_MCL1-01          P---------LAESITDVLVRSKRDWIVKQRGW-----D-GFVEFFHVED
Q3C2I0_BCL2A1-01        M------CKDISFFVAEFITENTGEWIKQNGGW-----ENGFVKKFET--
F1MV39_BCL2L10-01       DDGVSRDCRLLVALLCAQFCERHRAWLMANGGW-----D-GFCLFFSQSF
Q05KI8_BCL2L2-01        Q---------VQEWMVAYLETRLADWIHSSGGW-----A-EFTALYGVGA
Q1RMX3_BCL2L2-01        Q---------VQEWMVAYLETRLADWIHSSGGW-----A-EFTALYGDGA
F1MQX4_MCL1-01          P---------LAESITDVLVRSKRDWIVKERGW-----D-GFVEFFHVED
E1B9B3_BCL2L10-01       -----------ALLCAQFCERH-RAWLMTNGGWVSAKDA-GLVGSLGRAH
F6R2C4_BCL2-01          S---------IALWMTEYLNRHLHTWIQDNGGW-----D-AFVELYG---
O02718_BCL2-01          S---------IALWMTEYLNRHLHTWIQDNGGW-----D-AFVELYG---
Q05KJ0_BCL2L1-02        R---------IATWMATYLNDHLEPWIQENGGW-----D-TFVELYGNNA
Q05KJ0_BCL2L1-01        R---------IATWMATYLNDHLEPWIQENGGW-----D-TFVELYGNNA
A0A3Q1LRT3_BCL2L1-      Q---------VTTSTATYLNNHLKPWIQENGGW-----D-TFVELYESNT
                                                 *:  . **        :        

A5PJR2_MCL1-01          L----------------------------------EGGIRNVLLAFAGVA
Q3C2I0_BCL2A1-01        -----------------------------------KSGWLTFLEVTGKIC
F1MV39_BCL2L10-01       -----------------------------------QPSWERQLVWFFLAY
Q05KI8_BCL2L2-01        LE---------------------------EARRLREGNWASVRTVLTGAV
Q1RMX3_BCL2L2-01        LE---------------------------EARRLREGNWASVRTVLTGAV
F1MQX4_MCL1-01          L----------------------------------EGGIRNVLLAFAGVA
E1B9B3_BCL2L10-01       AAGWILSLLQPLIPAILGKTAGLVFPLILDSNNHNLLLDKIIVSSKILIS
F6R2C4_BCL2-01          -----------------------------PSMRPLFDFSWLSLKALLSLA
O02718_BCL2-01          -----------------------------PSMRPLFDFSWLSLKALLSLA
Q05KJ0_BCL2L1-02        AA---------------------------ESRKGQERFNRWFLTG-MTVA
Q05KJ0_BCL2L1-01        AA---------------------------ESRKGQERFNRWFLTG-MTVA
A0A3Q1LRT3_BCL2L1-      TN---------------------------ESQKGQERFNCWSLTTRLWLF
                                                                          

A5PJR2_MCL1-01          GVGA----GLAYLIR-------------------
Q3C2I0_BCL2A1-01        --ETLCRLKQYY----------------------
F1MV39_BCL2L10-01       WTAIII---IYFWIKLL-----------------
Q05KI8_BCL2L2-01        ALGALVTVGAFFASK-------------------
Q1RMX3_BCL2L2-01        ALGALVTVGAFFASK-------------------
F1MQX4_MCL1-01          GVGA----GLAYLIR-------------------
E1B9B3_BCL2L10-01       ---TCLTLSNQAKLKCERPNQSKPPSETFLSAFM
F6R2C4_BCL2-01          LVGACITLGAYLGHK-------------------
O02718_BCL2-01          LVGACITLGAYLGHK-------------------
Q05KJ0_BCL2L1-02        ---GVVLLGSLFSRK-------------------
Q05KJ0_BCL2L1-01        ---GVVLLGSLFSRK-------------------
A0A3Q1LRT3_BCL2L1-      ---GIFLIKHIFTKQPSNCTLEHLSGRYATLL--
                                                          

© 1998-2019