Dataset for protein Bcl2l10 of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


E1B9B3_BCL2L10-01      MTEGGAMVDPFRERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAA
F1MV39_BCL2L10-01      VADGQ---ESLVERTARLLMDYLEFCAREPGTPAPAPSTPEAAVLRHVAA
                       :::*    :.: **************************************

E1B9B3_BCL2L10-01      RIQEANRNVLPLYRRCRRHRVELVARMAQRLLDEDPGPSWGRVASLVTFA
F1MV39_BCL2L10-01      RIQEANRNVLPLYRRCRRHRVELVARMAQRLLDEDPGPSWGRVASLVTFA
                       **************************************************

E1B9B3_BCL2L10-01      GSLLERPPQTTRRQEKRDDDGVSRDCRLLVALLCAQFCERHRAWLMTNGG
F1MV39_BCL2L10-01      GSLLERPPQTTRRQ-KRDDDGVSRDCRLLVALLCAQFCERHRAWLMANGG
                       ************** *******************************:***

E1B9B3_BCL2L10-01      WVSAKDAGLVGSLGRAHAAGWILSLLQPLIPAILGKTAGLVFPLILDSNN
F1MV39_BCL2L10-01      W-----------------DGFCLFFSQSFQPS------------------
                       *                  *: * : *.: *:                  

E1B9B3_BCL2L10-01      HNLLLDKIIVSSKILISTCLTLSNQAKLKCERPNQSKPPSETFLSAFM
F1MV39_BCL2L10-01      ----WERQLVWFFLAYWTAIIIIY------------------FWIKLL
                            :. :*   :   *.: :                    *   ::

© 1998-2019