Dataset for protein Bcl-xL of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q05KJ0_BCL2L1-02        MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSA
Q05KJ0_BCL2L1-01        MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSA
A0A3Q1LRT3_BCL2L1-      MSQSNRELVVDFLSYKLSQKGYSWSQFS--------------VRYGNPQW
                        ****************************                  .*. 

Q05KJ0_BCL2L1-02        INGNASWHLADSPAVNGATGHSRSSDAREVIPMAAVKQALREAGDEFELR
Q05KJ0_BCL2L1-01        INGNASWHLADSPAVNGATGHSRSSDAREVIPMAAVKQALREAGDEFELR
A0A3Q1LRT3_BCL2L1-      ISGNPSWHLADSPTVNGATGHSRSLDARKMIPMTTVKQALREASNEFKLR
                        *.**.********:********** ***::***::********.:**:**

Q05KJ0_BCL2L1-02        YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
Q05KJ0_BCL2L1-01        YRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGAL
A0A3Q1LRT3_BCL2L1-      YQQTFSDLMSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFSFSGTL
                        *..:**** ***.****** ******:****** *:**.:******.*:*

Q05KJ0_BCL2L1-02        CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
Q05KJ0_BCL2L1-01        CVESVDKEMQVLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAA
A0A3Q1LRT3_BCL2L1-      CMKSIDKEIHVLVSQVTTSTATYLNNHLKPWIQENGGWDTFVELYESNTT
                        *::*:***::****.::*  *****:**:**************** .*::

Q05KJ0_BCL2L1-02        AESRKGQERFNRWFLTG-MTVAGVVLLGSLFSRK----------------
Q05KJ0_BCL2L1-01        AESRKGQERFNRWFLTG-MTVAGVVLLGSLFSRK----------------
A0A3Q1LRT3_BCL2L1-      NESQKGQERFNCWSLTTRLWLFGIFLIKHIFTKQPSNCTLEHLSGRYATL
                         **.******* * **  : : *:.*:  :*:.:                

Q05KJ0_BCL2L1-02        -
Q05KJ0_BCL2L1-01        -
A0A3Q1LRT3_BCL2L1-      L
                         

© 1998-2019