Dataset for protein Bcl-2 of organism Bos taurus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6R2C4_BCL2-01      MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPS
O02718_BCL2-01      MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPS
                    ************************************************************

F6R2C4_BCL2-01      RTSPPPPPAAAAGPAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRF
O02718_BCL2-01      RTSPPPPPAAAAGPAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARERF
                    ********************************************************* **

F6R2C4_BCL2-01      ATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHTWIQ
O02718_BCL2-01      ATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHTWIQ
                    ************************************************************

F6R2C4_BCL2-01      DNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
O02718_BCL2-01      DNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
                    *************************************************

© 1998-2019