Dataset for protein BCL-2-like of organism Bos mutus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


L8IZT5_BCL2A1-01      -MTDTEFGYVHGLAEDYLKYVLQIQ-------------------------
L8HP19_BCL2L2-02      MATPASAPDTRALVADFVGYKLRQKGY-----------------------
L8HP19_BCL2L2-01      MATPASAPDTRALVADFVGYKLRQKGY-----------------------
L8J061_BCL2L1-01      -----MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDM
                                . *. *:: * *  :                         

L8IZT5_BCL2A1-01      ----------------------QPGSKPSKISR------VLQDVASSVQD
L8HP19_BCL2L2-02      ------------------VCGAGPGEGPAAD--------PLHQAMRAAGD
L8HP19_BCL2L2-01      ------------------VCGAGPGEGPAAD--------PLHQAMRAAGD
L8J061_BCL2L1-01      ETPSAINGNASWHLADSPAVNGATGHSRSSDAREVIPMAAVKQALREAGD
                                             .*   :           :::.   . *

L8IZT5_BCL2A1-01      EVERTLKQCLDKFDV---VSVDTARTIFNQVMEKEFEDGIVNWGRIVTIF
L8HP19_BCL2L2-02      EFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFF
L8HP19_BCL2L2-01      EFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGG-PNWGRLVAFF
L8J061_BCL2L1-01      EFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDG-VNWGRIVAFF
                      *.*   .. :..:     :: .:*   * ** :: * .*  ****:*::*

L8IZT5_BCL2A1-01      AFEGILTKKLLGKCIASDMDMCKDISYFVAEFITENTGEWIKQNGGWENG
L8HP19_BCL2L2-02      VFGAALCAESVNKEMEP---LVGQVQEWMVAYLETRLADWIHSSGGWAE-
L8HP19_BCL2L2-01      VFGAALCAESVNKEMEP---LVGQVQEWMVAYLETRLADWIHSSGGWAE-
L8J061_BCL2L1-01      SFGGALCVESVDKEMQV---LVSRIATWMATYLNDHLEPWIQENGGWDT-
                       * . *  : :.* :     :   :  ::. ::  .   **:..***   

L8IZT5_BCL2A1-01      FVKKFETK------------SGWLTF-LEVTGKIC-ETLCRLKQYY---
L8HP19_BCL2L2-02      FTALYGDGALEEARRLRE--GNWASVRTVLTGAVALGALVTVGAFFASK
L8HP19_BCL2L2-01      FTALYGDGALEEARRLRE--GNWASVRTVLTGAVALGALVTVGAFFASK
L8J061_BCL2L1-01      FVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSL------FSRK
                      *.  :               . *      ::* :   :*      :   

© 1998-2019