Dataset for protein Mcl-1 of organism Astyanax mexicanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B1IEV7_MCL1-01      -MNPTAISLLCDGTSPVLYRTEKEEKLPRTERPERGLEGLQSAKGVSMG-
A0A3B1K5R1_MCL1-01      MMSPQDMCSYNKKTADIV--------------PRVAVRGGGGGAGLSLGL
                         *.*  :.   . *: ::              *  .: *  .. *:*:* 

A0A3B1IEV7_MCL1-01      ------------GGSLPDSPLADVDFIQDFSCRCPGALEAETRRLMVEFY
A0A3B1K5R1_MCL1-01      AADIRPTRPGVDDGSVPSSPLSDCGEMAVGNCKQYETLDGDTREIISDFL
                                    .**:*.***:* . :   .*.   :*:.:** :: :* 

A0A3B1IEV7_MCL1-01      RGYLG--QKPREQSPALRTMSRVVAGVVLKHGIAYNGMVQKLNLEEQDDS
A0A3B1K5R1_MCL1-01      RNFCGLSRSCGGHGAVVQTMKRVVDDLVVKHGIAYKGMLNKLGMEDRGDD
                        *.: *  ..   :...:.**.*** .:*:******:**::**.:*:..*.

A0A3B1IEV7_MCL1-01      MDIISSVAKALFSDGTTNWGRIVSLVAFGAVVCDHLKKKSRDHCVENVAQ
A0A3B1K5R1_MCL1-01      MYVIRAVAKELFSDGITNWGRVASLVAFGAVVSKHQHDMGRGHCVSLVGE
                        * :* :*** ***** *****:.*********..* :. .*.***. *.:

A0A3B1IEV7_MCL1-01      HISTYLNTHQHQWLINNNAWDGFVEFFREDDSESRVRNALMAFAGFAGLG
A0A3B1K5R1_MCL1-01      ELSSYLLSDERDWLLKNKAWDGFVEFFRVPDPESTMRNALMAFVTVAGLG
                         :*:** : :.:**::*:**********  *.** :*******. .****

A0A3B1IEV7_MCL1-01      AGLALLMR
A0A3B1K5R1_MCL1-01      ASIAFLAR
                        *.:*:* *

© 1998-2019