Dataset for protein BCL-2-like of organism Astyanax mexicanus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3B1JJ42_BCL2L1-      VMSYYNRELVVYFIKYKLSQRNYPTNHIGLMEETNRTEGGQEAEGNAEAA
A0A3B1IEV7_MCL1-01      -----MNPTAISLLCDGTSPVLYRTEKEEKLPRTERPERGLEGLQSAKGV
A0A3B1K5R1_MCL1-01      ----MMSPQDMCSYNKKTADIV--------------PRVAVRGGGGGAGL
                                  :       :                 .  .  .  .. . 

A0A3B1JJ42_BCL2L1-      GVTPTAVV--------NGSVNGTSHGAAGSPTSSPQRRA-----------
A0A3B1IEV7_MCL1-01      SMG-------------GGSLPDSPLADVDFIQDFSCRCPGALEAETRRLM
A0A3B1K5R1_MCL1-01      SLGLAADIRPTRPGVDDGSVPSSPLSDCGEMAVGNCKQYETLDGDTREII
                        .:              .**: .:. .  .       .             

A0A3B1JJ42_BCL2L1-      -----------NGARGLDAVKEALRDSANEFELRYSRAFSDLSSQLHITP
A0A3B1IEV7_MCL1-01      VEFYRGYLG--QKPREQSPALRTMSRVVAGVVLKHGIAYNGMVQKLNLEE
A0A3B1K5R1_MCL1-01      SDFLRNFCGLSRSCGGHGAVVQTMKRVVDDLVVKHGIAYKGMLNKLGMED
                                   .     ...  ::   .  . :.:. *:..: .:* :  

A0A3B1JJ42_BCL2L1-      -ATAYQSFESVMDEVFRDGV-NWGRVVGLFAFGGALCVECVEKEMSPLVG
A0A3B1IEV7_MCL1-01      QDDSMDIISSVAKALFSDGTTNWGRIVSLVAFGAVVCDHLKKKSRDHCVE
A0A3B1K5R1_MCL1-01      RGDDMYVIRAVAKELFSDGITNWGRVASLVAFGAVVSKHQHDMGRGHCVS
                               : :* . :* **  ****:..*.***..:.    .   .  * 

A0A3B1JJ42_BCL2L1-      RIAEWMTVYLDNHIQPWIQEQGGWERFAEIFGNDTAAESRRMQERYKMWL
A0A3B1IEV7_MCL1-01      NVAQHISTYLNTHQHQWLINNNAWDGFVEFFREDDSESRVRNA-------
A0A3B1K5R1_MCL1-01      LVGEELSSYLLSDERDWLLKNKAWDGFVEFFRVPDPESTMRNA-------
                         :.: :: ** .  . *: :: .*: *.*:*    . .  *         

A0A3B1JJ42_BCL2L1-      LVGMTLFTGIVVGSLIAQKRL
A0A3B1IEV7_MCL1-01      LMAFAGFAGLGAGLALLMR--
A0A3B1K5R1_MCL1-01      LMAFVTVAGLGASIAFLAR--
                        *:.:. .:*: ..  :  .  

© 1998-2019