Dataset for protein Mcl-1 of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5CFH3_MCL1-01      MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGG
A0A2K5C7L5_MCL1-01      MFGLQRNALIGLNLYCEWAGLGTGSGGTTPPGGRLLATEKEASAQREVGG
A0A2K5CFH3_MCL1-03      MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATEKEASAQREVGG
A0A2K5DMS4_MCL1-01      MFGFQ--VVIRLNLYCGAIPPGP---------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
                                                                          

A0A2K5CFH3_MCL1-01      GEAGAVIGGSAGASPPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFA
A0A2K5C7L5_MCL1-01      GEAGVVIGGSAGASPSAALTPDAR----------------GSCGRCWFFA
A0A2K5CFH3_MCL1-03      GEAGAVIGGSAGASPPAALVPDARRVVRPPPIGAEVPDVTATPSRLLFFA
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
                                                                          

A0A2K5CFH3_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEP
A0A2K5C7L5_MCL1-01      PTRRAAPLEEMEAPAADAIMSPEEELDRYEPEPLGKRPAVLPLLELVEEP
A0A2K5CFH3_MCL1-03      PTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEP
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
                                                                          

A0A2K5CFH3_MCL1-01      GNGSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A2K5C7L5_MCL1-01      GNDSSTDGSLPSTPP-----------TSLEIISRYLREQATGAKDTKPMD
A0A2K5CFH3_MCL1-03      GNGSSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMG
A0A2K5DMS4_MCL1-01      ------------------------------------RLLATGAKDTKPMG
A0A2K5EPX0_MCL1-02      --------------------------------------------------
A0A2K5EPX0_MCL1-01      --------------------------------------------------
                                                                          

A0A2K5CFH3_MCL1-01      RSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVM
A0A2K5C7L5_MCL1-01      RSGAASRKALETLRRVGDGVQRNHETAFQ-----V---------------
A0A2K5CFH3_MCL1-03      RSGAASRKALETLRRVGDGVQRNHETAFQGWVCGV---------------
A0A2K5DMS4_MCL1-01      RSEAANSKALETLRGVGEGVPRNHEMALQGMLRNLDNKNEDNVKSFY---
A0A2K5EPX0_MCL1-02      ----------------SQSYNNLKITTC--MLRKLDIKNKDDVKSLSRVM
A0A2K5EPX0_MCL1-01      ----------------NASCSRPACFSSPGMLRKLDIKNKDDVKSLSRVM
                                        . .  .    :       :               

A0A2K5CFH3_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
A0A2K5C7L5_MCL1-01      ----------------------------------------------LPCR
A0A2K5CFH3_MCL1-03      ----------------------------------------------LPCR
A0A2K5DMS4_MCL1-01      ------GVTNWGRIVTLSSFGAFVAKHLKTINQESCIEPLAESI------
A0A2K5EPX0_MCL1-02      VHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
A0A2K5EPX0_MCL1-01      VHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
                                                                          

A0A2K5CFH3_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLALSLI
A0A2K5C7L5_MCL1-01      RPRRW--HQKCAAGFCRCCWSRSWFGISNKIAL-----------------
A0A2K5CFH3_MCL1-03      GPRRW--HQKCAAGFCRCCWSRSWFG------------------------
A0A2K5DMS4_MCL1-01      -------RYSRWDGFVEFFRVEDLEGGIRNGLLAFAGVAGVGTDLAYLIR
A0A2K5EPX0_MCL1-02      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFACVAGVGAGLAYLIR
A0A2K5EPX0_MCL1-01      TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFACVAGVGAGLAYLIR
                               .     **    .  .  *                        

A0A2K5CFH3_MCL1-01      HI
A0A2K5C7L5_MCL1-01      --
A0A2K5CFH3_MCL1-03      --
A0A2K5DMS4_MCL1-01      --
A0A2K5EPX0_MCL1-02      --
A0A2K5EPX0_MCL1-01      --
                          

© 1998-2019