Dataset for protein BCL-2-like of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A2K5C7L5_MCL1-01      -----------------------------------------MFGLQRNAL
A0A2K5CFH3_MCL1-03      -----------------------------------------MFGLQRNAV
A0A2K5CFH3_MCL1-01      -----------------------------------------MFGLQRNAV
A0A2K5EB04_BCL2-01      ----------------------MAHAGRTGYDNREIVMKYIHYKLSQRGY
A0A2K5EBP4_BCL2L1-      ----------------------------MSQSNRELVVDFLSYKLSQKGY
A0A2K5CFH3_MCL1-02      MFGLQRNAVIGLNLYCGGAGLGAGSGGATPPGGRLLATGA----------
A0A2K5F974_BCL2L10      -----------------------MADPLRQRTER-LVADYLEY-------
A0A2K5CWZ4_BCL2L2-      MPLLVLCPYIHASLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5CWZ4_BCL2L2-      ------------HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5DMS4_MCL1-01      ----------------------------MFGFQVVIRLNL--YCGAIPPG
A0A2K5D2I1_BCL2A1-      ------------------------MTDCEFGYIHNLTQDYLRYVLQIP--
A0A2K5D2I1_BCL2A1-      ------------------------MTDCEFGYIHNLTQDYLRYVLQIP--
                                                                          

A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      V----------------------CGAGPGEG-------------------
A0A2K5C7L5_MCL1-01      IGLN--------------LYCEWAGLGTGSG-------------------
A0A2K5CFH3_MCL1-03      IGLN--------------LYCGGAGLGAGSG-------------------
A0A2K5CFH3_MCL1-01      IGLN--------------LYCGGAGLGAGSG-------------------
A0A2K5EB04_BCL2-01      EWDA-GDVGAAPPGAAPAPGIFSSQPGHTPGPAAPRDPVSRTSPPPPPAA
A0A2K5EBP4_BCL2L1-      SWSQFSDVEENRTEAPEGTDSEMETPSAING-----NPSWHLADSPAVNG
A0A2K5CFH3_MCL1-02      -KDT--------------------KPMGRSG-------------------
A0A2K5F974_BCL2L10      -CSQ--------------------EPGTPES-------------------
A0A2K5CWZ4_BCL2L2-      VCGA--------------------GPG--EG-------------------
A0A2K5CWZ4_BCL2L2-      VCGA--------------------GPG--EG-------------------
A0A2K5DMS4_MCL1-01      PRLL-------------ATGAKDTKPMGRSE-------------------
A0A2K5D2I1_BCL2A1-      ----------------------------QSG-------------------
A0A2K5D2I1_BCL2A1-      ----------------------------QSG-------------------
                                                                          

A0A2K5EBP4_BCL2L1-      --------------------MWKRTGLRPQKGLIRRWRPPVPSMLHITPG
A0A2K5EPY9_MCL1-02      ------------------SQSYNNLKITTC--MLRK--------LDIKNK
A0A2K5EPY9_MCL1-01      ------------------NASCSRPACFSSPGMLRK--------LDIKNK
A0A2K5CWZ4_BCL2L2-      -------------PAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPG
A0A2K5C7L5_MCL1-01      -------------GTTPP------------GGRLLATEKEASAQREVGGG
A0A2K5CFH3_MCL1-03      -------------GATPP------------GGRLLATEKEASAQREVGGG
A0A2K5CFH3_MCL1-01      -------------GATPP------------GGRLLATEKEASAQREVGGG
A0A2K5EB04_BCL2-01      PAAAATGPALSPVPPV--VHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPF
A0A2K5EBP4_BCL2L1-      ATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPG
A0A2K5CFH3_MCL1-02      -------------AASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
A0A2K5F974_BCL2L10      -------------PPSTAEAAVLRAMAAGVRKLYRSFFSAYLG----YPG
A0A2K5CWZ4_BCL2L2-      -------------PAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPG
A0A2K5CWZ4_BCL2L2-      -------------PAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPG
A0A2K5DMS4_MCL1-01      -------------AANSKALETLRGVGEGVPRNHEMALQGMLRNLDNKNE
A0A2K5D2I1_BCL2A1-      -------------TGPSKTSRVLQKVAFSVQKEVEKSLKPCLDNVNIVSI
A0A2K5D2I1_BCL2A1-      -------------TGPSKTSRVLQKVAFSVQKEVEKSLKPCLDNVNIVSI
                                                                          

A0A2K5EBP4_BCL2L1-      TAYQSFEQVVNELFRD-GV-NWGRIVAFFSFGGALCV-------------
A0A2K5EPY9_MCL1-02      DDVKSLSRVMVHVFSD-GVTNWGRIVTLISFGAFVAK-------------
A0A2K5EPY9_MCL1-01      DDVKSLSRVMVHVFSD-GVTNWGRIVTLISFGAFVAK-------------
A0A2K5CWZ4_BCL2L2-      SAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALCA-------------
A0A2K5C7L5_MCL1-01      EA--------GVVIGG--SAGASPSAALTPDAR-----------------
A0A2K5CFH3_MCL1-03      EA--------GAVIGG--SAGASPPAALVPDARRVVR-------------
A0A2K5CFH3_MCL1-01      EA--------GAVIGG--SAGASPPAALVPDARRVVR-------------
A0A2K5EB04_BCL2-01      TARGRFATVVEELFRD--GVNWGRIVAFFEFGGVMCV-------------
A0A2K5EBP4_BCL2L1-      TAYQSFEQVVNELFRD--GVNWGRIVAFFSFGGALCV-------------
A0A2K5CFH3_MCL1-02      DDVKSLSRVMVHVFSDG-VTNWGRIVTLISFGAFVAK-------------
A0A2K5F974_BCL2L10      NRVELVARMAEALLSDSPGPTWGNVVMLLAFAGTLLERGPLVTARWKKWG
A0A2K5CWZ4_BCL2L2-      SAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALCA-------------
A0A2K5CWZ4_BCL2L2-      SAQQRFTQVSDELFQG--GPNWGRLVAFFVFGAALCA-------------
A0A2K5DMS4_MCL1-01      DNVKSFY----------GVTNWGRIVTLSSFGAFVAK-------------
A0A2K5D2I1_BCL2A1-      DNARMIFSQVMEKEFEDGIINWGRIVTIFAFEGILIK-------------
A0A2K5D2I1_BCL2A1-      DNARMIFSQVMEKEFEDGIINWGRIVTIFAFEGILIK-------------
                                              .  . :                      

A0A2K5EBP4_BCL2L1-      -ESVDKEMQVLVSR---------IAAWMATYLNDHLEP----WIQENGGW
A0A2K5EPY9_MCL1-02      -HLKTINQESCIEP---------LAESITDVLVRTKRD----WLVKQRGW
A0A2K5EPY9_MCL1-01      -HLKTINQESCIEP---------LAESITDVLVRTKRD----WLVKQRGW
A0A2K5CWZ4_BCL2L2-      -ESVNKEMEPLVGQ---------VQEWMVAYLETRLAD----WIHSSGGW
A0A2K5C7L5_MCL1-01      -------------G---------SCGRCWFFAPTRRAA----PLEEMEAP
A0A2K5CFH3_MCL1-03      -PPPIGAEVPDVTA---------TPSRLLFFAPTRRAA----PLEEMEAP
A0A2K5CFH3_MCL1-01      -PPPIGAEVPDVTA---------TPSRLLFFAPTRRAA----PLEEMEAP
A0A2K5EB04_BCL2-01      -ESVNREMSPLVDN---------IALWMTEYLNRHLHT----WIQDNGGW
A0A2K5EBP4_BCL2L1-      -ESVDKEMQVLVSR---------IAAWMATYLNDHLEP----WIQENGGW
A0A2K5CFH3_MCL1-02      -HLKTINQESCIEP---------LAESITDVLVRTKRD----WLVKQRGW
A0A2K5F974_BCL2L10      FQSRLKEPEGDVAR---------DCQRLVALLSSRLVGQHRAWLEAQGGW
A0A2K5CWZ4_BCL2L2-      -ESVNKEMEPLVGQ---------VQEWMVAYLETRLAD----WIHSSGGW
A0A2K5CWZ4_BCL2L2-      -ESVNKEMEPLVGQ---------VQEWMVAYLETRLAD----WIHSSGGW
A0A2K5DMS4_MCL1-01      -HLKTINQESCIEPLAESIRYSRWDGFVEFFRVEDL----------EGGI
A0A2K5D2I1_BCL2A1-      -KLLRERIAPDVDT------YKEISYFVAEFIMNNTGE----WISQNGGW
A0A2K5D2I1_BCL2A1-      -KLLRERIAPDVDT------YKEISYFVAEFIMNNTGE----WISQNGGW
                                                                        . 

A0A2K5EBP4_BCL2L1-      DT------------------------------------------------
A0A2K5EPY9_MCL1-02      DG------------------------------------------------
A0A2K5EPY9_MCL1-01      DG------------------------------------------------
A0A2K5CWZ4_BCL2L2-      ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPV---IMSIE
A0A2K5C7L5_MCL1-01      AADAIMSPEEELDRYEPEPLGKRPAVLPLLELVEEPGNDSSTDGSLPSTP
A0A2K5CFH3_MCL1-03      AADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPGNGSSTDGSLPSTP
A0A2K5CFH3_MCL1-01      AADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEPGNGSSTDGSLPSTP
A0A2K5EB04_BCL2-01      DA------------------------------------------------
A0A2K5EBP4_BCL2L1-      DT------------------------------------------------
A0A2K5CFH3_MCL1-02      DG------------------------------------------------
A0A2K5F974_BCL2L10      VS------------------------------------------------
A0A2K5CWZ4_BCL2L2-      AE------------------------------------------------
A0A2K5CWZ4_BCL2L2-      AE------------------------------------------------
A0A2K5DMS4_MCL1-01      RN------------------------------------------------
A0A2K5D2I1_BCL2A1-      EN------------------------------------------------
A0A2K5D2I1_BCL2A1-      AK------------------------------------------------
                                                                          

A0A2K5EBP4_BCL2L1-      --------------------------------------FVELYGNNAAAE
A0A2K5EPY9_MCL1-02      --------------------------------------FVEFFHVEDLEG
A0A2K5EPY9_MCL1-01      --------------------------------------FVEFFHVEDLEG
A0A2K5CWZ4_BCL2L2-      EKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKG
A0A2K5C7L5_MCL1-01      P-----------TSLE----------------------IISRYLREQATG
A0A2K5CFH3_MCL1-03      PPAEEEEDELYRQSLE----------------------IISRYLREQATG
A0A2K5CFH3_MCL1-01      PPAEEEEDELYRQSLE----------------------IISRYLREQATG
A0A2K5EB04_BCL2-01      --------------------------------------FVELYGPSM---
A0A2K5EBP4_BCL2L1-      --------------------------------------FVELYGNNAAAE
A0A2K5CFH3_MCL1-02      --------------------------------------FVEFFHVEDL--
A0A2K5F974_BCL2L10      --------------------------------------MR--------RG
A0A2K5CWZ4_BCL2L2-      --------------------------------------FTALYGDGALEE
A0A2K5CWZ4_BCL2L2-      --------------------------------------FTALYGDGALEE
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5EBP4_BCL2L1-      SRKGQ---ERFNRWFLTGMTVAGVVLLGSLFSRK----------------
A0A2K5EPY9_MCL1-02      GIRN----------VLLAFACVAGVGAGLAYLIR----------------
A0A2K5EPY9_MCL1-01      GIRN----------VLLAFACVAGVGAGLAYLIR----------------
A0A2K5CWZ4_BCL2L2-      FAYIEFS-DKESVRTSLALDESLFRGRQIKVDFKAFIYSSLTQV------
A0A2K5C7L5_MCL1-01      AKDTKPM-DRSGAASRKALETLRRVGDGVQRNHETAFQV-----------
A0A2K5CFH3_MCL1-03      AKDTKPM-GRSGAASRKALETLRRVGDGVQRNHETAFQGWVCGV------
A0A2K5CFH3_MCL1-01      AKDTKPM-GRSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNED
A0A2K5EB04_BCL2-01      ----RPLFDFSWLSLKTLLSLALVGAC-----------------------
A0A2K5EBP4_BCL2L1-      SRKGQERFN------RWFLTGMTVAGV-----------------------
A0A2K5CFH3_MCL1-02      --------EGGIRNVLLAFAGVAGVGAG----------------------
A0A2K5F974_BCL2L10      TR--ASRVAGNIGWLLLLLQDLLLAGIMEKTAGPGFPVMVVNSS------
A0A2K5CWZ4_BCL2L2-      AR--RLR-EGNWASVRTVLTGAVALGAL----------------------
A0A2K5CWZ4_BCL2L2-      AR--RLR-EGNWASVRTVLTGAVALGAL----------------------
A0A2K5DMS4_MCL1-01      --------------GLLAFAGVAGVGTDLAYLIR----------------
A0A2K5D2I1_BCL2A1-      ----GFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYY-------------
A0A2K5D2I1_BCL2A1-      ---------------WHSLLLV---LVESVAQKERKMAL-----------
                                          :                               

A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      -----------IPKRTNRPG---------------------ISTTDRGFP
A0A2K5C7L5_MCL1-01      -----------LPCRRPRRW---------------------HQKCAAGFC
A0A2K5CFH3_MCL1-03      -----------LPCRGPRRW---------------------HQKCAAGFC
A0A2K5CFH3_MCL1-01      DVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLA
A0A2K5EB04_BCL2-01      -------------------------------------------ITLGAYL
A0A2K5EBP4_BCL2L1-      -------------------------------------------VLLGSLF
A0A2K5CFH3_MCL1-02      -------------------------------------------LALSLIH
A0A2K5F974_BCL2L10      -----------------------------------------IHLLLDTII
A0A2K5CWZ4_BCL2L2-      -------------------------------------------VTVGAFF
A0A2K5CWZ4_BCL2L2-      -------------------------------------------VTVGAFF
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5EBP4_BCL2L1-      --------------------------------------------------
A0A2K5EPY9_MCL1-02      --------------------------------------------------
A0A2K5EPY9_MCL1-01      --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      RAR--YRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY----
A0A2K5C7L5_MCL1-01      RCC----------W---SRSWFGISNKIAL--------------------
A0A2K5CFH3_MCL1-03      RCC----------W---SRSWFG---------------------------
A0A2K5CFH3_MCL1-01      ESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGV
A0A2K5EB04_BCL2-01      GHK-----------------------------------------------
A0A2K5EBP4_BCL2L1-      SRK-----------------------------------------------
A0A2K5CFH3_MCL1-02      I-------------------------------------------------
A0A2K5F974_BCL2L10      RSF-----------------------------------------------
A0A2K5CWZ4_BCL2L2-      ASK-----------------------------------------------
A0A2K5CWZ4_BCL2L2-      ASK-----------------------------------------------
A0A2K5DMS4_MCL1-01      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
A0A2K5D2I1_BCL2A1-      --------------------------------------------------
                                                                          

A0A2K5EBP4_BCL2L1-      -----------
A0A2K5EPY9_MCL1-02      -----------
A0A2K5EPY9_MCL1-01      -----------
A0A2K5CWZ4_BCL2L2-      -----------
A0A2K5C7L5_MCL1-01      -----------
A0A2K5CFH3_MCL1-03      -----------
A0A2K5CFH3_MCL1-01      GAGLALSLIHI
A0A2K5EB04_BCL2-01      -----------
A0A2K5EBP4_BCL2L1-      -----------
A0A2K5CFH3_MCL1-02      -----------
A0A2K5F974_BCL2L10      -----------
A0A2K5CWZ4_BCL2L2-      -----------
A0A2K5CWZ4_BCL2L2-      -----------
A0A2K5DMS4_MCL1-01      -----------
A0A2K5D2I1_BCL2A1-      -----------
A0A2K5D2I1_BCL2A1-      -----------
                                   

© 1998-2019