Dataset for protein Bcl-w of organism Aotus nancymaae

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K5CWZ4_BCL2L2-      -----------------------MATPASAPDTRALVADFVGYKLRQKGY
A0A2K5CWZ4_BCL2L2-      MPLLVLCPYIHASLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
A0A2K5CWZ4_BCL2L2-      ------------HLSSLPLIAARMATPASAPDTRALVADFVGYKLRQKGY
                                               ***************************

A0A2K5CWZ4_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
A0A2K5CWZ4_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
A0A2K5CWZ4_BCL2L2-      VCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQ
                        **************************************************

A0A2K5CWZ4_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5CWZ4_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
A0A2K5CWZ4_BCL2L2-      RFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMV
                        **************************************************

A0A2K5CWZ4_BCL2L2-      AYLETRLADWIHSSGGWELEAIKARVREMEEEAEKLKELQNEVEKQMNMS
A0A2K5CWZ4_BCL2L2-      AYLETRLADWIHSSGGWA-EFTALYGDGALEEARRLRE------------
A0A2K5CWZ4_BCL2L2-      AYLETRLADWIHSSGGWA-EFTALYGDGALEEARRLRE------------
                        *****************  *          *** .*.*            

A0A2K5CWZ4_BCL2L2-      PPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNR
A0A2K5CWZ4_BCL2L2-      ---GNWASV------------RTVLTGAVALGALVT--------------
A0A2K5CWZ4_BCL2L2-      ---GNWASV------------RTVLTGAVALGALVT--------------
                           ** ..*            *:: .* *  ** .               

A0A2K5CWZ4_BCL2L2-      VTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVDFKAFI
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5CWZ4_BCL2L2-      YSSLTQVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSR
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
A0A2K5CWZ4_BCL2L2-      --------------------------------------------------
                                                                          

A0A2K5CWZ4_BCL2L2-      PRGRVYRGRARATSWYSPY
A0A2K5CWZ4_BCL2L2-      -----------VGAFFASK
A0A2K5CWZ4_BCL2L2-      -----------VGAFFASK
                                   . ::::. 

© 1998-2019