Dataset for protein BCL-2-like of organism Anolis carolinensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


R4GAJ0_MCL1-01        MFNKKSMVLVCGGAPSMAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKA
R4GAJ0_MCL1-02        ----------------MAPNTPASPGAGGGVGESSGGNNNDGGGVSVPKA
H9GHK7_BCL2L1-01      --------------------------------------------------
H9GPE7_BCL2-01        --------------------------------------------------
                                                                        

R4GAJ0_MCL1-01        SGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGEGEQPKWR
R4GAJ0_MCL1-02        SGLFSERPRPLIGGGPRAGPLRALIGPWEGSQRALIGCDAEGEGEQPKWR
H9GHK7_BCL2L1-01      ----------------MSSSNRALVVDFLSYKLSQRGHS---------WH
H9GPE7_BCL2-01        ----------MAHPGIRGYDNREIVLRYIHYKLSQKGYD---------WV
                                       .   * ::  :   : :  * .         * 

R4GAJ0_MCL1-01        PASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPL
R4GAJ0_MCL1-02        PASLPLPEGELDGCEEAEEEEAATVPSSTPSPDKEMAEEEGEKGKGGPPL
H9GHK7_BCL2L1-01      EIEMESGEEAMEPANETGNTLNGS-PSWHPSPSHVI---------NGASE
H9GPE7_BCL2-01        ------------ASGDRGKSASLS-PELLNSDPVST---------NAPRE
                                   . :  :    : *.   *              ...  

R4GAJ0_MCL1-01        FPDHLRKTTLEVVGRYLREAADEAGSKGTGPKFSFQGLLGRFGSSPNEAE
R4GAJ0_MCL1-02        FPDHLRKTTLEVVGRYLREAADEAGSKGTGPKFSFQGLLGRFGSSPNEAE
H9GHK7_BCL2L1-01      HPELLEEEE-------------------------------------EENP
H9GPE7_BCL2-01        EPDPVPQV------------------------------------------
                       *: : :                                           

R4GAJ0_MCL1-01        VARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLASVAEVTTEVFR
R4GAJ0_MCL1-02        VARALETLRRVGESLREKHLLAFQGMLRKLEIKKEEDLASVAEVTTEVFR
H9GHK7_BCL2L1-01      RVDVSQTLREAGDEFELRYRRAFSDLTSQLHITLGTAYQSFEQVVNELFH
H9GPE7_BCL2-01        ---VHTTLRQAGDEFSRRYRRDFAQMSGQLHLTPSTARSRFVAVVEELFQ
                         .  *** .*:.:  .:   *  :  :* :.       .  *. *:*.

R4GAJ0_MCL1-01        DGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREW
R4GAJ0_MCL1-02        DGIINWGRIVTLISFGAFVAKHLKSINQENAINTLIEIITDVLVTDKREW
H9GHK7_BCL2L1-01      DG-VNWGRIVAFFSFGGALCVESVDKEMQGLVVRIASWMTTYLTEHLDPW
H9GPE7_BCL2-01        DG-VNWGRIVAFFEFGGMLCVESVSREMSPLVDNIATWMTEYLNQYLRNW
                      ** :******:::.**. :.    . : .  :  :   :*  *      *

R4GAJ0_MCL1-01        LLKHNAWHNCV----------------------------------
R4GAJ0_MCL1-02        LLKHNAWEGFVQFFHVEDIEGGIRNVLVAFASVAGIGAGLAYMIR
H9GHK7_BCL2L1-01      IQENGGWKSKG-------------GQIISVIYTHHSEVCLNTYID
H9GPE7_BCL2-01        IQENGGW--------------------------------------
                      : ::..*                                      

© 1998-2019