Dataset for protein BCL-2-like of organism Anas platyrhynchos platyrhynchos

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A493SSZ7_BCL2A1-      --------------------------------------------------
A0A493U0E8_MCL1-01      GGWGTESWRNTSWPSKGPARSDHLGSVLWKSEASSQGPARIDHFGSVPWN
A0A493T1X3_BCL2-01      --------------------------------------------MAHPGR
A0A493TIA6_BCL2L1-      --------------------------------------------------
                                                                          

A0A493SSZ7_BCL2A1-      METAEFYYVYYLAQDYLQYVLQE---------------------------
A0A493U0E8_MCL1-01      SEASPRGVVGTAHFGSVLWNSEASPWGWGGTDHFGAVFPEPSSGIFSRPA
A0A493T1X3_BCL2-01      RGYDNREIV----LKYIHYKLSQRGYDWAAGED-----RAPAPTALAPAA
A0A493TIA6_BCL2L1-      MSSGNRELV----IDFVSYKLSQKGYSWSQLEE-----EDENRTELASEA
                                *       : :  .                            

A0A493SSZ7_BCL2A1-      -------------------SHLGPAQTRVAH-------------------
A0A493U0E8_MCL1-01      RTNPLGSAPRGRGGDLTILGWFHPTQKRAPEPAGRRDAAPPAAGCCTFKK
A0A493T1X3_BCL2-01      AAVAAAGTP----------SRHRPAGLLSPHPEPPGSAA-----------
A0A493TIA6_BCL2L1-      AAV-LNGSP----------SWHPPAGQVV------NGAA-----------
                                           ..  *:                         

A0A493SSZ7_BCL2A1-      ---------------------VLRNIASSLQDQTEEALR-----------
A0A493U0E8_MCL1-01      CKRFRAGPHPFPHHPAGRDFWGFTTPGQIFGVLARKPHSGEQGGVTVEDL
A0A493T1X3_BCL2-01      ASEAPPGEGLRPAPPVVHL--ALRQAGDEFSRRYQRDFA-----------
A0A493TIA6_BCL2L1-      VHRSSLEVHELVQSAAVRQ--ALREAGDEFELRYRRAFS-----------
                                              :   .. :                    

A0A493SSZ7_BCL2A1-      ----PFLDRIDISSVDVAKRIFNGVMDEKFADGNTNWGRITTIFTFGGLL
A0A493U0E8_MCL1-01      GRSLGMLRKLEIKKEE-DLQAVGEVAAHLFSDGVTNWGRVVTLISFGAFV
A0A493T1X3_BCL2-01      ----QMSGQLHLTPFT-ARGRFVAVVEELFRDGV-NWGRIVAFFEFGGVM
A0A493TIA6_BCL2L1-      ----DLTSQLHITPGT-AYQSFEQVVNELFRDGV-NWGRIVAFFSFGGAL
                             :  .: :.        .  *    * **  ****:.::: **. :

A0A493SSZ7_BCL2A1-      TKKLQEHGVQLTGEKKEQISYFITEYIINNKAEWIDANGGWENGF-----
A0A493U0E8_MCL1-01      ARHLKSVKQEKS---IGSLARIITDALVSSKREWLVSQGGWEGFVDFF--
A0A493T1X3_BCL2-01      CVESVNREMSPL---VDSIAAWMTEYLNRHLHNWIQDNGGWDAFVELYGN
A0A493TIA6_BCL2L1-      CVESVDKEMRVL---VGRIVAWMTTYLSDHLDPWIQENGGWVRGCSF---
                             .            :   :*  :      *:  :***         

A0A493SSZ7_BCL2A1-      ---------------------------LTKFERRSLLSFSKITDLFVAVF
A0A493U0E8_MCL1-01      -----------------------RVEDLEGSIRNVLMAFAGVAGLGASLA
A0A493T1X3_BCL2-01      SMRPLFDFSWISLKTILSL-----------------VLVGACITLGAYLG
A0A493TIA6_BCL2L1-      -CTPLGDLGWIWPLSALQITPPPRPPPPRTPPRPLPLPPSLPPSLPPGLG
                                                            :  .    *   : 

A0A493SSZ7_BCL2A1-      SLFRE
A0A493U0E8_MCL1-01      YMIR-
A0A493T1X3_BCL2-01      HK---
A0A493TIA6_BCL2L1-      F----
                             

© 1998-2019