Dataset for protein Mcl-1 of organism Anabas testudineus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1GX28_MCL1-02      MLPSGRTAMKLATGGMSCLMLPQNGVVEYSSGVNSPQITMSSSIDACNGN
A0A3Q1GX28_MCL1-01      MLPSGRTAMKLATGGMSCLMLPQNGVVEYSSGVNSPQITMSSSIDACNGN
                        **************************************************

A0A3Q1GX28_MCL1-02      AALKRPKNLDVSSSNGYATKNIGANSDDIEDGSLPCTPELMSDSEVDVSS
A0A3Q1GX28_MCL1-01      AALKRPKNLDVSSSNGYATKNIGANSDDIEDGSLPCTPELMSDSEVDVSS
                        **************************************************

A0A3Q1GX28_MCL1-02      CPAGDEVLENDTRQLLSQFLQDFSGLTKPRWCETKELSTMKRVVNDVLEK
A0A3Q1GX28_MCL1-01      CPAGDEVLENDTRQLLSQFLQDFSGLTKPRWCETKELSTMKRVVNDVLEK
                        **************************************************

A0A3Q1GX28_MCL1-02      HRYAYNGMINKLSLDDKVDDVSFITAVAQSLFSDGTTNWGRIASLVAFGA
A0A3Q1GX28_MCL1-01      HRYAYNGMINKLSLDDKVDDVSFITAVAQSLFSDGTTNWGRIASLVAFGA
                        **************************************************

A0A3Q1GX28_MCL1-02      AVCQHLKEKHRENCVDLVAQEISSYLLSAQRDWLVRNNSWDGFVEFFRVA
A0A3Q1GX28_MCL1-01      AVCQHLKEKHRENCVDLVAQEISSYLLSAQRDWLVRNNSWDGFVEFFRVA
                        **************************************************

A0A3Q1GX28_MCL1-02      DPESTVRKSLMAFAGLAGIGASLALLISAVRLQPLHLH
A0A3Q1GX28_MCL1-01      DPESTVRKSLMAFAGLAGIGASLALLISSCSVM-----
                        ****************************:  :      

© 1998-2019