Dataset for protein BCL-2-like of organism Anabas testudineus

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1GX28_MCL1-02      MLPSGRTAMKLATGGMSCLM---------LPQNGVVEYSSGVNSPQITMS
A0A3Q1GX28_MCL1-01      MLPSGRTAMKLATGGMSCLM---------LPQNGVVEYSSGVNSPQITMS
A0A3Q1I5N1_BCL2-01      --MANECNRNIVEKYICHKL-------------------SKRGYAWGFHD
A0A3Q1IAB0_BCL2L10      ------------MFQLSWGLFLLEAESADKCADAEGKLRVHRGSPSAVRM
A0A3Q1GZ93_BCL2L1-      ----MSQNRELVVFYITYKL-------------------SQRNYPLNHLG
A0A3Q1GZ93_BCL2L1-      ----MSQNRELVVFYITYKL-------------------SQRNYPLNHLG
A0A3Q1GZ93_BCL2L1-      ----MSQNRELVVFYITYKL-------------------SQRNYPLNHLG
A0A3Q1JZ46_BCL2L1-      MEEMSNSNRELVEFFIMYKL-------------------SQRNHPASLLR
A0A3Q1JZ46_BCL2L1-      MEEMSNSNRELVEFFIMYKL-------------------SQRNHPASLLR
                                       :   :                      . .     

A0A3Q1GX28_MCL1-02      SSIDACNGNAALKRPKNLDVSSSNGYATKNIGANSDDIEDGSLPCTPELM
A0A3Q1GX28_MCL1-01      SSIDACNGNAALKRPKNLDVSSSNGYATKNIGANSDDIEDGSLPCTPELM
A0A3Q1I5N1_BCL2-01      AQ----------DE-----DAANNGSAVPPPPTLVRRCREASTGPDS---
A0A3Q1IAB0_BCL2L10      CR----------EQTDIAGRKMSCGLWKDTLALAEDYLSLCCTSPWP---
A0A3Q1GZ93_BCL2L1-      LN----------ETPNRTDGGEDGLSEEQRIATHANGTFNGRSPGTP---
A0A3Q1GZ93_BCL2L1-      LN----------ETPNRTDGGEDGLSEEQRIATHANGTFNGRSPGTP---
A0A3Q1GZ93_BCL2L1-      LN----------ETPNRTDGGEDGLSEEQRIATHANGTFNGRSPGTP---
A0A3Q1JZ46_BCL2L1-      PD----------DT---------GGVGDRPNSAAANGLPVSRSGELG---
A0A3Q1JZ46_BCL2L1-      PD----------DT---------GGVGDRPNSAAANGLPVSRSGELG---
                                    .                                     

A0A3Q1GX28_MCL1-02      SDSEVDVSSCPAGDEVLENDTRQLLSQFLQDFSGLTKPRWCETKELSTMK
A0A3Q1GX28_MCL1-01      SDSEVDVSSCPAGDEVLENDTRQLLSQFLQDFSGLTKPRWCETKELSTMK
A0A3Q1I5N1_BCL2-01      ------------------------------DSIPQHCRRLPPSDPHAALH
A0A3Q1IAB0_BCL2L10      ------------------------------APP-------PPSESAAAMR
A0A3Q1GZ93_BCL2L1-      ------------------------------PASPLRQQRLPSTTSLDAVK
A0A3Q1GZ93_BCL2L1-      ------------------------------PASPLRQQRLPSTTSLDAVK
A0A3Q1GZ93_BCL2L1-      ------------------------------PASPLRQQRLPSTTSLDAVK
A0A3Q1JZ46_BCL2L1-      ------------------------------NSS-------PPCKSMEAVK
A0A3Q1JZ46_BCL2L1-      ------------------------------NSS-------PPCKSMEAVK
                                                                       ::.

A0A3Q1GX28_MCL1-02      RVVNDVLEKHRYAYNGMINKLSLDDKVDDVS---FITAVAQSLFSDGTTN
A0A3Q1GX28_MCL1-01      RVVNDVLEKHRYAYNGMINKLSLDDKVDDVS---FITAVAQSLFSDGTTN
A0A3Q1I5N1_BCL2-01      RVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDG-VN
A0A3Q1IAB0_BCL2L10      RLAQDMEKQHQVRFHSLAQTFLKQCGPDPCS---SLRKVMEELVGDGHMN
A0A3Q1GZ93_BCL2L1-      EALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDG-VN
A0A3Q1GZ93_BCL2L1-      EALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDG-VN
A0A3Q1GZ93_BCL2L1-      EALRDSANEFELRYARAFSDLHNQLHITPATAYQSFENVMDEVFRDG-VN
A0A3Q1JZ46_BCL2L1-      TALRDSADEFELLFTQAFSDLSSQLDVTPDTAYQSFKSVMDELFKDG-VN
A0A3Q1JZ46_BCL2L1-      TALRDSADEFELLFTQAFSDLSSQLDVTPDTAYQSFKSVMDELFKDG-VN
                           .:  .:    :      :  :      :    :  * :.:. **  *

A0A3Q1GX28_MCL1-02      WGRIASLVAFGAAVCQHLKEKHREN----------------CVDLVAQEI
A0A3Q1GX28_MCL1-01      WGRIASLVAFGAAVCQHLKEKHREN----------------CVDLVAQEI
A0A3Q1I5N1_BCL2-01      WGRIIAFFEFGGTVCVECASKEEMTP---------------QVNNIAEWM
A0A3Q1IAB0_BCL2L10      WGRVVSLFTFTGVLARQMLEQKDKKPGLDLGKGQELGQEPGQCRGLAETI
A0A3Q1GZ93_BCL2L1-      WGRIVGLFAFGGALCVECVEKEMSQ----------------LVGRIVEWM
A0A3Q1GZ93_BCL2L1-      WGRIVGLFAFGGALCVECVEKEMSQ----------------LVGRIVEWM
A0A3Q1GZ93_BCL2L1-      WGRIVGLFAFGGALCVECVEKEMSQ----------------LVGRIVEWM
A0A3Q1JZ46_BCL2L1-      WGRIVGLFAFGGVLCVECVEKNMSE----------------LVSRIADWM
A0A3Q1JZ46_BCL2L1-      WGRIVGLFAFGGVLCVECVEKNMSE----------------LVSRIADWM
                        ***: .:. * ..:.    .:                        :.: :

A0A3Q1GX28_MCL1-02      SSYLLSAQRDWLVRNNSWDGFVEFFRVADPESTVRKSLMAFAGLAGIGAS
A0A3Q1GX28_MCL1-01      SSYLLSAQRDWLVRNNSWDGFVEFFRVADPESTVRKSLMAFAGLAGIGAS
A0A3Q1I5N1_BCL2-01      TEYLNGPLHSWIQDNGGWDAFVDLYD-RQRESVFSCSWSSIKTVFGLAAL
A0A3Q1IAB0_BCL2L10      ADYLGEEKKDWLLENDGWEGFCKF----SCSAREVSQDSSMKRALFAA--
A0A3Q1GZ93_BCL2L1-      TVYLDNHIQPWIQSQGGWERFAELFG-HDAAAEGRRSQESFKKWLLAGMT
A0A3Q1GZ93_BCL2L1-      TVYLDNHIQPWIQSQGGWERFAELFG-HDAAAEGRRSQESFKKWLLAGMT
A0A3Q1GZ93_BCL2L1-      TVYLDNHIQPWIQSQGGWERFAELFG-HDAAAEGRRSQESFKKWLLAGMT
A0A3Q1JZ46_BCL2L1-      TMYLDEHISPWIQSQGGWDCFAEIFG-QDAAAEARRSREALRRWLLVGVV
A0A3Q1JZ46_BCL2L1-      TMYLDEHISPWIQSQGGWDCFAEIFG-QDAAAEARRSREALRRWLLVGVV
                        : **      *:  :..*: * .:    .  :    .  ::      .  

A0A3Q1GX28_MCL1-02      LALLISAVRLQPLHLH
A0A3Q1GX28_MCL1-01      LALLISSCSVM-----
A0A3Q1I5N1_BCL2-01      GAASLTIGAYLAQK--
A0A3Q1IAB0_BCL2L10      --AGVGLAGLTFLLVR
A0A3Q1GZ93_BCL2L1-      LVTGVVVGSLIAQKRL
A0A3Q1GZ93_BCL2L1-      LVTGVVVGSLIAQKRL
A0A3Q1GZ93_BCL2L1-      LVTGVVVGSLIAQKRL
A0A3Q1JZ46_BCL2L1-      LLTGVLLGVLIAKKR-
A0A3Q1JZ46_BCL2L1-      LLTGVLLGVLIAKKR-
                            :           

© 1998-2019