Dataset for protein Bcl-xL of organism Anabas testudineus

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1GZ93_BCL2L1-      ----MSQNRELVVFYITYKLSQRNYPLNHLGLNETPNRTDGGEDGLSEEQ
A0A3Q1GZ93_BCL2L1-      ----MSQNRELVVFYITYKLSQRNYPLNHLGLNETPNRTDGGEDGLSEEQ
A0A3Q1GZ93_BCL2L1-      ----MSQNRELVVFYITYKLSQRNYPLNHLGLNETPNRTDGGEDGLSEEQ
A0A3Q1JZ46_BCL2L1-      MEEMSNSNRELVEFFIMYKLSQRNHPASLLRPDDT---------GGVGDR
A0A3Q1JZ46_BCL2L1-      MEEMSNSNRELVEFFIMYKLSQRNHPASLLRPDDT---------GGVGDR
                             ..***** *:* *******:* . *  ::*         *   :.

A0A3Q1GZ93_BCL2L1-      RIATHANGTFNGRSPGTPPASPLRQQRLPSTTSLDAVKEALRDSANEFEL
A0A3Q1GZ93_BCL2L1-      RIATHANGTFNGRSPGTPPASPLRQQRLPSTTSLDAVKEALRDSANEFEL
A0A3Q1GZ93_BCL2L1-      RIATHANGTFNGRSPGTPPASPLRQQRLPSTTSLDAVKEALRDSANEFEL
A0A3Q1JZ46_BCL2L1-      PNSAAANGLPVSRSGELGNSS-------PPCKSMEAVKTALRDSADEFEL
A0A3Q1JZ46_BCL2L1-      PNSAAANGLPVSRSGELGNSS-------PPCKSMEAVKTALRDSADEFEL
                          :: ***   .**     :*       *. .*::*** ******:****

A0A3Q1GZ93_BCL2L1-      RYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGA
A0A3Q1GZ93_BCL2L1-      RYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGA
A0A3Q1GZ93_BCL2L1-      RYARAFSDLHNQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGA
A0A3Q1JZ46_BCL2L1-      LFTQAFSDLSSQLDVTPDTAYQSFKSVMDELFKDGVNWGRIVGLFAFGGV
A0A3Q1JZ46_BCL2L1-      LFTQAFSDLSSQLDVTPDTAYQSFKSVMDELFKDGVNWGRIVGLFAFGGV
                         ::.***** .** :** ******:.****:*.****************.

A0A3Q1GZ93_BCL2L1-      LCVECVEKEMSQLVGRIVEWMTVYLDNHIQPWIQSQGGWERFAELFGHDA
A0A3Q1GZ93_BCL2L1-      LCVECVEKEMSQLVGRIVEWMTVYLDNHIQPWIQSQGGWERFAELFGHDA
A0A3Q1GZ93_BCL2L1-      LCVECVEKEMSQLVGRIVEWMTVYLDNHIQPWIQSQGGWERFAELFGHDA
A0A3Q1JZ46_BCL2L1-      LCVECVEKNMSELVSRIADWMTMYLDEHISPWIQSQGGWDCFAEIFGQDA
A0A3Q1JZ46_BCL2L1-      LCVECVEKNMSELVSRIADWMTMYLDEHISPWIQSQGGWDCFAEIFGQDA
                        ********:**:**.**.:***:***:**.*********: ***:**:**

A0A3Q1GZ93_BCL2L1-      AAEGRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
A0A3Q1GZ93_BCL2L1-      AAEGRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
A0A3Q1GZ93_BCL2L1-      AAEGRRSQESFKKWLLAGMTLVTGVVVGSLIAQKRL
A0A3Q1JZ46_BCL2L1-      AAEARRSREALRRWLLVGVVLLTGVLLGVLIAKKR-
A0A3Q1JZ46_BCL2L1-      AAEARRSREALRRWLLVGVVLLTGVLLGVLIAKKR-
                        ***.***.*::..***.*:.*:***::* ***:** 

© 1998-2019