Dataset for protein BCL-2-like of organism Amphiprion percula

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8RQX7_MCL1-02      MNMIPTTTKRTAFMNYLIFPQNGVVEGPMHYGSGDSSPQIAVASSIDSHN
A0A3P8RQX7_MCL1-01      MNMIPTTTKRTAFMNYLIFPQNGVVEGPMHYGSGDSSPQIAVASSIDSHN
A0A3P8RL82_BCL2L10      MSCGLWKETLV------LAEDYLSL-------------------------
A0A3P8S9L3_BCL2-01      MANECNRNIVEKYICHKLSKRGYVW-------------------------
A0A3P8TL99_BCL2L1-      --MSQNRELVVFYIKYKLSQRNYPL-------------------------
A0A3P8TL99_BCL2L1-      --MSQNRELVVFYIKYKLSQRNYPL-------------------------
A0A3P8U812_BCL2L1-      -MSYSNRELVEFFVSYKLSQRNYPT-------------------------
                                         :                                

A0A3P8RQX7_MCL1-02      GNVGSSETPKRPKNLGVNGYASKNLRQDSDSMEEGSLPCTPELQSDSETD
A0A3P8RQX7_MCL1-01      GNVGSSETPKRPKNLGVNGYASKNLRQDSDSMEEGSLPCTPELQSDSETD
A0A3P8RL82_BCL2L10      CCASPHQAPPPPSESAA---------------------------------
A0A3P8S9L3_BCL2-01      GFDDVRDEDAANNGSVVDPPPTLVRRCHEAST--GPDNESDPHLCRRLPQ
A0A3P8TL99_BCL2L1-      NHMVLNEAPSRTDGGEARLGEEQRTETHANGTFNGTSPGTPPPSPRRLAS
A0A3P8TL99_BCL2L1-      NHMVLNEAPSRTDGGEARLGEEQRTETHANGTFNGTSPGTPPPSPRRLAS
A0A3P8U812_BCL2L1-      SLLRPEDAEGRTDGDKA-------NSASSNGLLVNSRGG-----------
                              :     .   .                                 

A0A3P8RQX7_MCL1-02      VSSCPAGDELLENDTRQLLRRFLRDFTGLSKP--RWNESKALSTMKRVVD
A0A3P8RQX7_MCL1-01      VSSCPAGDELLENDTRQLLRRFLRDFTGLSKP--RWNESKALSTMKRVVD
A0A3P8RL82_BCL2L10      ---------AMRRLAQDMEKQHQARFHSLTQTFLRQCGPDLCSSLRKVME
A0A3P8S9L3_BCL2-01      SDPHAAIHRVLREAGDELERLYQPDFTEMSRQ-LYLTSTTAQRRFAEVID
A0A3P8TL99_BCL2L1-      TATMDAVKEALRDTANEFELRYARAFSDLHSQ-LHITPATAYQSFENVMD
A0A3P8TL99_BCL2L1-      TATMDAVKEALRDTANEFELRYARAFSDLHSQ-LHITPATAYQSFENVMD
A0A3P8U812_BCL2L1-      ---IEAVKSALKDAADEFELLFTQAFSDLSSQ-LDITPETAYHSFKSVMD
                                  :     ::   .   *  :               :  *::

A0A3P8RQX7_MCL1-02      DVLDKHRYAYNGMINKLSLDDRGDDVSFVSAVAKSLFADRTTNWGRITSL
A0A3P8RQX7_MCL1-01      DVLDKHRYAYNGMINKLSLDDRGDDVSFVSAVAKSLFADRTTNWGRITSL
A0A3P8RL82_BCL2L10      E----------------------------------LVGDGHLNWGRVVSL
A0A3P8S9L3_BCL2-01      E----------------------------------LFRDG-VNWGRIIAF
A0A3P8TL99_BCL2L1-      E----------------------------------VFRDG-VNWGRIVGL
A0A3P8TL99_BCL2L1-      E----------------------------------VFRDG-VNWGRIVGL
A0A3P8U812_BCL2L1-      E----------------------------------VFKDG-VNWGRIVGL
                        :                                  :. *   ****: .:

A0A3P8RQX7_MCL1-02      VAFGAVVCQYLKER-GRENCVD---------------LVSQEISTYLLSE
A0A3P8RQX7_MCL1-01      VAFGAVVCQYLKER-GRENCVD---------------LVSQEISTYLLSE
A0A3P8RL82_BCL2L10      FTFTGVLARQLLEQKDTKPGLDPGKQQELGQGPVNCRELAETIADYLGEE
A0A3P8S9L3_BCL2-01      FEFGGTVCVECAAKEEMTSQVD---------------NIAEWMTEYLNGP
A0A3P8TL99_BCL2L1-      FAFGGALCVECVEK-EMSPLVG---------------RIVEWMTVYLDNH
A0A3P8TL99_BCL2L1-      FAFGGALCVECVEK-EMSPLVG---------------RIVEWMTVYLDNH
A0A3P8U812_BCL2L1-      FCFGGVLCVECVDK-NMSELVP---------------RIADWMTMYLDEH
                        . * ..:.     .      :                 : : :: **   

A0A3P8RQX7_MCL1-02      QRDWLVKNNSWDGFVEFFRVADPELTVRNTLMAFAGFAGIGATLALLIR-
A0A3P8RQX7_MCL1-01      QRDWLVKNNSWDGFVEFFRVADPELTVRNTLMAFAGFAGIGATLALLIR-
A0A3P8RL82_BCL2L10      KKDWLLENDGWEGFCKF------SLSAREVSQDLSMKTALFAAAGVGLAG
A0A3P8S9L3_BCL2-01      LNSWIQDNGGWDAFVELYD-RQRDSVFSCSWPSIKTVFGLAALGAASLTI
A0A3P8TL99_BCL2L1-      IQDWIQSQGGWERFAEIFG-QDAAAESRKSQESFKKWLLVGMTVVTGVVV
A0A3P8TL99_BCL2L1-      IQDWIQSQGGWERFAEIFG-QDAAAESRKSQESFKKWLLVGMTVVTGVVV
A0A3P8U812_BCL2L1-      ISPWIQSQGGWECFAEIFG-QNAAAEARRSRDTLKRWLLVGGVLLMGVLA
                           *: .:..*: * ::                :     :       :  

A0A3P8RQX7_MCL1-02      ---------
A0A3P8RQX7_MCL1-01      ---------
A0A3P8RL82_BCL2L10      LTFLLVR--
A0A3P8S9L3_BCL2-01      GAYLTQK--
A0A3P8TL99_BCL2L1-      GSLIAQKRL
A0A3P8TL99_BCL2L1-      GSLIAQKRL
A0A3P8U812_BCL2L1-      GVLIAKKQ-
                                 

© 1998-2019