Dataset for protein Bcl-xL of organism Amphiprion percula

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8TL99_BCL2L1-      -MSQNRELVVFYIKYKLSQRNYPLNHMVLNEAPSRTDGGEARLGEEQRTE
A0A3P8TL99_BCL2L1-      -MSQNRELVVFYIKYKLSQRNYPLNHMVLNEAPSRTDGGEARLGEEQRTE
A0A3P8U812_BCL2L1-      MSYSNRELVEFFVSYKLSQRNYPTSLLRPEDAEGRTDGDKA-------NS
                           .***** *::.********* . :  ::* .****.:*       ..

A0A3P8TL99_BCL2L1-      THANGTFNGTSPGTPPPSPRRLASTATMDAVKEALRDTANEFELRYARAF
A0A3P8TL99_BCL2L1-      THANGTFNGTSPGTPPPSPRRLASTATMDAVKEALRDTANEFELRYARAF
A0A3P8U812_BCL2L1-      ASSNGLLVNSRGG--------------IEAVKSALKDAADEFELLFTQAF
                        : :** : .:  *              ::***.**.*:*:**** ::.**

A0A3P8TL99_BCL2L1-      SDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECV
A0A3P8TL99_BCL2L1-      SDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECV
A0A3P8U812_BCL2L1-      SDLSSQLDITPETAYHSFKSVMDEVFKDGVNWGRIVGLFCFGGVLCVECV
                        *** *** *** ***:**:.******.************.***.******

A0A3P8TL99_BCL2L1-      EKEMSPLVGRIVEWMTVYLDNHIQDWIQSQGGWERFAEIFGQDAAAESRK
A0A3P8TL99_BCL2L1-      EKEMSPLVGRIVEWMTVYLDNHIQDWIQSQGGWERFAEIFGQDAAAESRK
A0A3P8U812_BCL2L1-      DKNMSELVPRIADWMTMYLDEHISPWIQSQGGWECFAEIFGQNAAAEARR
                        :*:** ** **.:***:***:**. ********* *******:****:*.

A0A3P8TL99_BCL2L1-      SQESFKKWLLVGMTVVTGVVVGSLIAQKRL
A0A3P8TL99_BCL2L1-      SQESFKKWLLVGMTVVTGVVVGSLIAQKRL
A0A3P8U812_BCL2L1-      SRDTLKRWLLVGGVLLMGVLAGVLIAKKQ-
                        *.:::*.***** .:: **:.* ***:*. 

© 1998-2019