Dataset for protein Mcl-1 of organism Amphiprion ocellaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1BKL8_MCL1-02      MNMIPTTTKRTAFMNYLIFPQNGVVEGPMHYGSGDSSPQIAVASSIDSHN
A0A3Q1BKL8_MCL1-01      MNMIPTTTKRTAFMNYLIFPQNGVVEGPMHYGSGDSSPQIAVASSIDSHN
                        **************************************************

A0A3Q1BKL8_MCL1-02      GNVGSNETPKRPKNLGVNGYASKNLRQDSDSMEEGSLPCTPELQSDSETD
A0A3Q1BKL8_MCL1-01      GNVGSNETPKRPKNLGVNGYASKNLRQDSDSMEEGSLPCTPELQSDSETD
                        **************************************************

A0A3Q1BKL8_MCL1-02      VSSCPAGDELLENDTRQLLRRFLRDFTGLSKPRWNESKALSTMKRVVDDV
A0A3Q1BKL8_MCL1-01      VSSCPAGDELLENDTRQLLRRFLRDFTGLSKPRWNESKALSTMKRVVDDV
                        **************************************************

A0A3Q1BKL8_MCL1-02      LDKHRYAYNGMINKLSLDDRGDDVSFVSAVAKSLFADRTTNWGRITSLVA
A0A3Q1BKL8_MCL1-01      LDKHRYAYNGMINKLSLDDRGDDVSFVSAVAKSLFADRTTNWGRITSLVA
                        **************************************************

A0A3Q1BKL8_MCL1-02      FGAVVCQYLKERGRENCVDLVSQEISTYLLSEQRDWLVKNNSWDGFVEFF
A0A3Q1BKL8_MCL1-01      FGAVVCQYLKERGRENCVDLVSQEISTYLLSEQRDWLVKNNSWDGFVEFF
                        **************************************************

A0A3Q1BKL8_MCL1-02      RVADPELTVRNTLMAFAGFAGIGATLALLISGLAAVGLTQSTENSCKDAH
A0A3Q1BKL8_MCL1-01      RVADPELTVRNTLMAFAGFAGIGATLALLIR-------------------
                        ******************************                    

A0A3Q1BKL8_MCL1-02      ISCCR
A0A3Q1BKL8_MCL1-01      -----
                             

© 1998-2019