Dataset for protein BCL-2-like of organism Amphiprion ocellaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1BKL8_MCL1-02      MNMIPTTTKRTAFMNYLIFPQNGVVEGPMHYGSGDSSPQIAVASSIDSHN
A0A3Q1BKL8_MCL1-01      MNMIPTTTKRTAFMNYLIFPQNGVVEGPMHYGSGDSSPQIAVASSIDSHN
A0A3Q1D2L0_BCL2L10      --------------------------------------------------
A0A3Q1B8C3_BCL2-01      MANECNRNIVEKYICHKLSKRGYVW-------------------------
A0A3Q1BQA0_BCL2L1-      -MSYSNRELVEFFVSDKLSQRNYPT-------------------------
A0A3Q1DHJ3_BCL2L1-      --MSQNRELVVFYIKYKLSQRNYPL-------------------------
A0A3Q1DHJ3_BCL2L1-      --MSQNRELVVFYIKYKLSQRNYPL-------------------------
A0A3Q1DHJ3_BCL2L1-      --MSQNRELVVFYIKYKLSQRNYPL-------------------------
                                                                          

A0A3Q1BKL8_MCL1-02      GNVGSNETPKRPKNLGVNGYASKNLRQDSDSMEEGSLPCTPELQSDSETD
A0A3Q1BKL8_MCL1-01      GNVGSNETPKRPKNLGVNGYASKNLRQDSDSMEEGSLPCTPELQSDSETD
A0A3Q1D2L0_BCL2L10      --------------MSCGLWKETLVLAEDYLSLCCASPHQAPPPPSESAA
A0A3Q1B8C3_BCL2-01      GFDDVRDEDAANNGSVVDPPPTLVRRCHEAST--GPDNESDPHLCRRLPQ
A0A3Q1BQA0_BCL2L1-      SLLRPEDAGGRTDGDKA-------NSASSNGLLVNSRGG-----------
A0A3Q1DHJ3_BCL2L1-      NHMVLNEAPSRTDGGEARLGEEQRTETHANGTFNGTSPGTPPPSPRRLAS
A0A3Q1DHJ3_BCL2L1-      NHMVLNEAPSRTDGGEARLGEEQRTETHANGTFNGTSPGTPPPSPRRLAS
A0A3Q1DHJ3_BCL2L1-      NHMVLNEAPSRTDGGEARLGEEQRTETHANGTFNGTSPGTPPPSPRRLAS
                                                           .              

A0A3Q1BKL8_MCL1-02      VSSCPAGDELLENDTRQLLRRFLRDFTGLSKP--RWNESKALSTMKRVVD
A0A3Q1BKL8_MCL1-01      VSSCPAGDELLENDTRQLLRRFLRDFTGLSKP--RWNESKALSTMKRVVD
A0A3Q1D2L0_BCL2L10      ---------AMRRLAQDMEKQHQARFHSLTQTFLRQCGPDLCSSLRKVME
A0A3Q1B8C3_BCL2-01      SDPHAAIHRVLREAGDELERLYQPDFTEMSRQ-LYLTSTTAQRRFAEVID
A0A3Q1BQA0_BCL2L1-      ---IEAVKSALKDAADEFELLFTQAFSDLSSQ-LDITPETAYHSFKSVMD
A0A3Q1DHJ3_BCL2L1-      TATMDAVKEALRDTANEFELRYARAFSDLHSQ-LHITPATAYQSFENVMD
A0A3Q1DHJ3_BCL2L1-      TATMDAVKEALRDTANEFELRYARAFSDLHSQ-LHITPATAYQSFENVMD
A0A3Q1DHJ3_BCL2L1-      TATMDAVKEALRDTANEFELRYARAFSDLHSQ-LHITPATAYQSFENVMD
                                  :     ::   .   *  :               :  *::

A0A3Q1BKL8_MCL1-02      DVLDKHRYAYNGMINKLSLDDRGDDVSFVSAVAKSLFADRTTNWGRITSL
A0A3Q1BKL8_MCL1-01      DVLDKHRYAYNGMINKLSLDDRGDDVSFVSAVAKSLFADRTTNWGRITSL
A0A3Q1D2L0_BCL2L10      EL----------------------------------VGDGHLNWGRVVSL
A0A3Q1B8C3_BCL2-01      EL----------------------------------FRDG-VNWGRIIAF
A0A3Q1BQA0_BCL2L1-      EV----------------------------------FKDG-VNWGRIVGL
A0A3Q1DHJ3_BCL2L1-      EV----------------------------------FRDG-VNWGRIVGL
A0A3Q1DHJ3_BCL2L1-      EV----------------------------------FRDG-VNWGRIVGL
A0A3Q1DHJ3_BCL2L1-      EV----------------------------------FRDG-VNWGRIVGL
                        ::                                  . *   ****: .:

A0A3Q1BKL8_MCL1-02      VAFGAVVCQYLKER-GRENCVD---------------LVSQEISTYLLSE
A0A3Q1BKL8_MCL1-01      VAFGAVVCQYLKER-GRENCVD---------------LVSQEISTYLLSE
A0A3Q1D2L0_BCL2L10      FTFTGVLARQLLEQKDTKLGLDPGKQQELGQGPVNCRELAETIADYLGEE
A0A3Q1B8C3_BCL2-01      FEFGGTVCVECAAKEEMTSQVD---------------NIAEWMTEYLNGP
A0A3Q1BQA0_BCL2L1-      FCFGGVLCVECVEK-NMSELVP---------------RIADWMTMYLDEH
A0A3Q1DHJ3_BCL2L1-      FAFGGALCVECVEK-EMSPLVG---------------RIVEWMTVYLDNH
A0A3Q1DHJ3_BCL2L1-      FAFGGALCVECVEK-EMSPLVG---------------RIVEWMTVYLDNH
A0A3Q1DHJ3_BCL2L1-      FAFGGALCVECVEK-EMSPLVG---------------RIVEWMTVYLDNH
                        . * ..:.     .      :                 : : :: **   

A0A3Q1BKL8_MCL1-02      QRDWLVKNNSWDGFVEFFRVADPELTVRNTLMAFAGFAGIGATLALLISG
A0A3Q1BKL8_MCL1-01      QRDWLVKNNSWDGFVEFFRVADPELTVRNTLMAFAGFAGIGATLALLIR-
A0A3Q1D2L0_BCL2L10      KKDWLLENDGWEGFCKF------SLSAREVSQDLSMKTALFAAAGVGLAG
A0A3Q1B8C3_BCL2-01      LNSWIQDNGGWDAFVELYD-RQRDSVFSCSWPSIKTVFGLAALGAASLTI
A0A3Q1BQA0_BCL2L1-      ISPWIQSQGGWECFAEIFG-QNAAAEARRSRDTLKRWLLVGGVLLMGVLA
A0A3Q1DHJ3_BCL2L1-      IQDWIQSQGGWERFAEIFG-QDAAAESRKSQESFKKWLLVGMTVVTGVVV
A0A3Q1DHJ3_BCL2L1-      IQDWIQSQGGWERFAEIFG-QDAAAESRKSQESFKKWLLVGMTVVTGVVV
A0A3Q1DHJ3_BCL2L1-      IQDWIQSQGGWERFAEIFG-QDAAAESRKSQESFKKWLLVGMTVVTGVVV
                           *: .:..*: * ::                :     :       :  

A0A3Q1BKL8_MCL1-02      LAAVGLTQSTENSCKDAHISCCR
A0A3Q1BKL8_MCL1-01      -----------------------
A0A3Q1D2L0_BCL2L10      LTFLLVR----------------
A0A3Q1B8C3_BCL2-01      GAYLTQK----------------
A0A3Q1BQA0_BCL2L1-      GVLIAKKQ---------------
A0A3Q1DHJ3_BCL2L1-      GSLIAQKRL--------------
A0A3Q1DHJ3_BCL2L1-      GSLIAQKRL--------------
A0A3Q1DHJ3_BCL2L1-      GSLIAQKRL--------------
                                               

© 1998-2019