Dataset for protein Bcl-xL of organism Amphiprion ocellaris

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1BQA0_BCL2L1-      MSYSNRELVEFFVSDKLSQRNYPTSLLRPEDAGGRTDGDKA-------NS
A0A3Q1DHJ3_BCL2L1-      -MSQNRELVVFYIKYKLSQRNYPLNHMVLNEAPSRTDGGEARLGEEQRTE
A0A3Q1DHJ3_BCL2L1-      -MSQNRELVVFYIKYKLSQRNYPLNHMVLNEAPSRTDGGEARLGEEQRTE
A0A3Q1DHJ3_BCL2L1-      -MSQNRELVVFYIKYKLSQRNYPLNHMVLNEAPSRTDGGEARLGEEQRTE
                           .***** *::. ******** . :  ::* .****.:*       ..

A0A3Q1BQA0_BCL2L1-      ASSNGLLVNSRGG--------------IEAVKSALKDAADEFELLFTQAF
A0A3Q1DHJ3_BCL2L1-      THANGTFNGTSPGTPPPSPRRLASTATMDAVKEALRDTANEFELRYARAF
A0A3Q1DHJ3_BCL2L1-      THANGTFNGTSPGTPPPSPRRLASTATMDAVKEALRDTANEFELRYARAF
A0A3Q1DHJ3_BCL2L1-      THANGTFNGTSPGTPPPSPRRLASTATMDAVKEALRDTANEFELRYARAF
                        : :** : .:  *              ::***.**.*:*:**** ::.**

A0A3Q1BQA0_BCL2L1-      SDLSSQLDITPETAYHSFKSVMDEVFKDGVNWGRIVGLFCFGGVLCVECV
A0A3Q1DHJ3_BCL2L1-      SDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECV
A0A3Q1DHJ3_BCL2L1-      SDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECV
A0A3Q1DHJ3_BCL2L1-      SDLHSQLHITPATAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECV
                        *** *** *** ***:**:.******.************.***.******

A0A3Q1BQA0_BCL2L1-      EKNMSELVPRIADWMTMYLDEHISPWIQSQGGWECFAEIFGQNAAAEARR
A0A3Q1DHJ3_BCL2L1-      EKEMSPLVGRIVEWMTVYLDNHIQDWIQSQGGWERFAEIFGQDAAAESRK
A0A3Q1DHJ3_BCL2L1-      EKEMSPLVGRIVEWMTVYLDNHIQDWIQSQGGWERFAEIFGQDAAAESRK
A0A3Q1DHJ3_BCL2L1-      EKEMSPLVGRIVEWMTVYLDNHIQDWIQSQGGWERFAEIFGQDAAAESRK
                        **:** ** **.:***:***:**. ********* *******:****:*.

A0A3Q1BQA0_BCL2L1-      SRDTLKRWLLVGGVLLMGVLAGVLIAKKQ-
A0A3Q1DHJ3_BCL2L1-      SQESFKKWLLVGMTVVTGVVVGSLIAQKRL
A0A3Q1DHJ3_BCL2L1-      SQESFKKWLLVGMTVVTGVVVGSLIAQKRL
A0A3Q1DHJ3_BCL2L1-      SQESFKKWLLVGMTVVTGVVVGSLIAQKRL
                        *.:::*.***** .:: **:.* ***:*. 

© 1998-2019