Dataset for protein Mcl-1 of organism Amphilophus citrinellus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q0RA11_MCL1-02      -----------------------------------------------MPE
A0A3Q0RA11_MCL1-03      MNTCTMRNCRMGSYKNVMDLFLPQNGVVDGTMHYGSGNSSPQDATGTPKD
A0A3Q0RA11_MCL1-01      ------------------------------SLPF------------TSPD
                                                                         :

A0A3Q0RA11_MCL1-02      RNGS-------AISTQLGLHPR----------------------------
A0A3Q0RA11_MCL1-03      SNGTPKRPNNLGVVSTNGYAPKNITDDVEDGSLPSTPEFHSDSESDEALE
A0A3Q0RA11_MCL1-01      SNGTPKRPNNLGVVSTNGYAPKNITDDVEDGSLPSTPEFHSDSESDEALE
                         **:       .: :  *  *.                            

A0A3Q0RA11_MCL1-02      ---------------------------------------------ISGMV
A0A3Q0RA11_MCL1-03      RETKSLITSFFRDFTGLSQRRWKESEALKTMKRVVADVLEKHRYAYNGMV
A0A3Q0RA11_MCL1-01      RETKSLITSFFRDFTGLSQRRWKESEALKTMKRVVADVLEKHRYAYNGMV
                                                                      .***

A0A3Q0RA11_MCL1-02      NKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEK
A0A3Q0RA11_MCL1-03      NKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEK
A0A3Q0RA11_MCL1-01      NKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVCQRLKEK
                        **************************************************

A0A3Q0RA11_MCL1-02      GRDNCVELVSQEISTYLLSDQRDWLVKNNAWDGFVEFFRVADPESTVRNT
A0A3Q0RA11_MCL1-03      GRDNCVELVSQEISTYLLSDQRDWLVKNNAWDGFVEFFRVADPESTVRNT
A0A3Q0RA11_MCL1-01      GRDNCVELVSQEISTYLLSDQRDWLVKNNAWDGFVEFFRVADPESTVRNT
                        **************************************************

A0A3Q0RA11_MCL1-02      LMAFAGFAGIGATLALLIR
A0A3Q0RA11_MCL1-03      LMAFAGFAGIGATLALLIR
A0A3Q0RA11_MCL1-01      LMAFAGFAGIGATLALLIR
                        *******************

© 1998-2019