Dataset for protein BCL-2-like of organism Amphilophus citrinellus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q0RA11_MCL1-02      --------------------------------------------------
A0A3Q0S9R1_BCL2L10      ----------------------MVPGLWKETLGL----------------
A0A3Q0S5Z7_BCL2-01      ---------MANEYNRNIVEKYICHKLSKRGYAW----------------
A0A3Q0RTF8_BCL2L1-      -----------MSQNRELVLFYITYKLSQRNYPL--------NHIVLNEP
A0A3Q0RA11_MCL1-03      MNTCTMRNCRMGSYKNVMDLFLPQNGVVDGTMHYGSGNSSPQDATGTPKD
A0A3Q0RA11_MCL1-01      ------------------------------SLPF------------TSPD
                                                                          

A0A3Q0RA11_MCL1-02      --------------------------------------------------
A0A3Q0S9R1_BCL2L10      ---------------------------AEDYLSLCCTSPHQVPP------
A0A3Q0S5Z7_BCL2-01      ---------GFDGVQDEDAANNGSINDPPPTLVRRCREPSNGPDGESNTH
A0A3Q0RTF8_BCL2L1-      SNRTDGGAAGLDEEQRIDTHANGTFNGTSPGTPPASPQRQQQPPSTTNLD
A0A3Q0RA11_MCL1-03      SNGTPKRPNNLGVVSTNGYAPKNITDDVEDGSLPSTPEFHSDSESDEALE
A0A3Q0RA11_MCL1-01      SNGTPKRPNNLGVVSTNGYAPKNITDDVEDGSLPSTPEFHSDSESDEALE
                                                                          

A0A3Q0RA11_MCL1-02      ---------------------------MPERNGSAISTQLGLHPRISGMV
A0A3Q0S9R1_BCL2L10      ----------------------PPSESAAAMRRLGQDIERQHQARFDNLA
A0A3Q0S5Z7_BCL2-01      LCRRLP-------------QSDPHADIHRVLREAGDELERLYQPDFTEMS
A0A3Q0RTF8_BCL2L1-      AVKEAL-------------------------RDTANEFELRYARAFNDLH
A0A3Q0RA11_MCL1-03      RETKSLITSFFRDFTGLSQRRWKESEALKTMKRVVADVLEKHRYAYNGMV
A0A3Q0RA11_MCL1-01      RETKSLITSFFRDFTGLSQRRWKESEALKTMKRVVADVLEKHRYAYNGMV
                                                       .    .           : 

A0A3Q0RA11_MCL1-02      NKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVC-QRLK-
A0A3Q0S9R1_BCL2L10      QTFLRHCGPDHCSSLRKVMEELVGDGHLNWGRVVSLFAFTGVLARKRLEQ
A0A3Q0S5Z7_BCL2-01      RQLHLTSATAQRRF-AEVIDELFRD-GVNWGRIIAFFEFGGTVC-VECAS
A0A3Q0RTF8_BCL2L1-      SQLHITPATAYQSF-ENVMDEVFRD-GVNWGRIVGLFAFGGALC-VECV-
A0A3Q0RA11_MCL1-03      NKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVC-QRLK-
A0A3Q0RA11_MCL1-01      NKLSLDERGEDVTFVSAVAKSLFADKTTNWGRIASLMAFGAVVC-QRLK-
                          :              * ..:. *   ****: .:: * ..:.      

A0A3Q0RA11_MCL1-02      EKGRDN-----------CVELVSQEISTYLLSDQRDWLVKNNAWDGFVEF
A0A3Q0S9R1_BCL2L10      KPGLDPGQQQELGQEPISCRELAETIADYLGEEKKDWLLDNDGWEGFCKY
A0A3Q0S5Z7_BCL2-01      NEGMTS-----------QVDNIAEWMTEYLNGPLNSWIQDNGGWDAFVEL
A0A3Q0RTF8_BCL2L1-      EKEMSP-----------LVGRIVEWMTVYLDNHIQPWIQSQGGWERFAEI
A0A3Q0RA11_MCL1-03      EKGRDN-----------CVELVSQEISTYLLSDQRDWLVKNNAWDGFVEF
A0A3Q0RA11_MCL1-01      EKGRDN-----------CVELVSQEISTYLLSDQRDWLVKNNAWDGFVEF
                        :                    : : :: **    . *: .:..*: * : 

A0A3Q0RA11_MCL1-02      FRVADPESTVRNTLMAFAGFAGIGATL-------ALLIR---
A0A3Q0S9R1_BCL2L10      SRSAREVSQDSSMKTALFAAAGVGLAGLT-----FLLVR---
A0A3Q0S5Z7_BCL2-01      YG-RQRESVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK--
A0A3Q0RTF8_BCL2L1-      FG-QDAAAESRRSQESFKKWLLVGMTVVTGVVAGALIAQKRL
A0A3Q0RA11_MCL1-03      FRVADPESTVRNTLMAFAGFAGIGATL-------ALLIR---
A0A3Q0RA11_MCL1-01      FRVADPESTVRNTLMAFAGFAGIGATL-------ALLIR---
                               :       ::     :.            : .   

© 1998-2019