Dataset for protein BCL-2-like of organism Ailuropoda melanoleuca

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G1L3M8_MCL1-01         MFGLKRNAVIGLNLYCGGAGLGAGSGGGXSGGRLLASGKEATARREIGGG
G1L3M8_MCL1-02         MFGLKRNAVIGLNLYCGGAGLGAGSGGGXSGGRLLASGKEATARREIGGG
G1LID1_BCL2-02         -----------------MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAG
G1LMC3_BCL2L2-01       -----------------------------------PYIHASLSSLTLTAA
G1LID1_BCL2-01         -----------------------------------PHPAASPRPFVRRWQ
G1LKR4_BCL2L10-01      -------------------------------------MADALRGTARLLT
                                                               :         

G1L3M8_MCL1-01         EAGAVIGGSAGASPPX-------------GAEGPDVTATPPRLLFLEPTR
G1L3M8_MCL1-02         EAGAVIGGSAGASPPAXXXXXXXXXXXXXGAEGPDVTATPPRLLFLEPTR
G1LID1_BCL2-02         DAAPAAAAA----------------------AGPALSPVPPVVHL-----
G1LMC3_BCL2L2-01       RMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQ-----
G1LID1_BCL2-01         VAPPSAAAAA---------------------AGPALSPVPPVVHL-----
G1LKR4_BCL2L10-01      DYLEYCAREP---------------------GTPARAPSTPEAAV-----
                             .                          *   . .          

G1L3M8_MCL1-01         RASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGG
G1L3M8_MCL1-02         RASPPEEMEGPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGEASGG
G1LID1_BCL2-02         --------------------------------------------------
G1LMC3_BCL2L2-01       --------------------------------------------------
G1LID1_BCL2-01         --------------------------------------------------
G1LKR4_BCL2L10-01      --------------------------------------------------
                                                                         

G1L3M8_MCL1-01         PCTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSG
G1L3M8_MCL1-02         PCTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDAKPLGGSG
G1LID1_BCL2-02         --------------------------------------------------
G1LMC3_BCL2L2-01       --------------------------------------------------
G1LID1_BCL2-01         --------------------------------------------------
G1LKR4_BCL2L10-01      --------------------------------------------------
                                                                         

G1L3M8_MCL1-01         AASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHV
G1L3M8_MCL1-02         AASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMVHV
G1LID1_BCL2-02         --------TLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEEL
G1LMC3_BCL2L2-01       --------AMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDEL
G1LID1_BCL2-01         --------TLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEEL
G1LKR4_BCL2L10-01      ---------LRSVAAQVQQRHERFLSDYRG-------YAGGNRVELVAQV
                                :* ..  .. ..   :                    :   :

G1L3M8_MCL1-01         FSD------GVTNWGRIVTLISFGAFVAKHLKSINQEGCIEPLAE-----
G1L3M8_MCL1-02         FSD------GVTNWGRIVTLISFGAFVAKHLKSINQEGCIEPLAE-----
G1LID1_BCL2-02         FRD------GV-NWGRIVAFFEFGGVMCVESVNREMSPLVDNIAL-----
G1LMC3_BCL2L2-01       FQG------GP-NWGRLVAFFVFGAALCAESVNKEMEPLVGQVQE-----
G1LID1_BCL2-01         FRD------GV-NWGRIVAFFEFGGVMCVESVNREMSPLVDNIAL-----
G1LKR4_BCL2L10-01      EREILAHPQPL-SWGRVVALLTFAGTLLERSPSGTYSNLGPDQELELGEW
                                   .***:*::: *.. :     .   .             

G1L3M8_MCL1-01         -------------SITDVLVRTKRDWLVKQRGWDGFVEFF-------HVE
G1L3M8_MCL1-02         -------------SITDVLVRTKRDWLVKQRGWDGFVEFF-------HVE
G1LID1_BCL2-02         -------------WMTEYLNRHLHTWIQDNGGWVGARPLE----------
G1LMC3_BCL2L2-01       -------------WMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARR
G1LID1_BCL2-01         -------------WMTEYLNRHLHTWIQDNGGWDAFVELYGPS----MQP
G1LKR4_BCL2L10-01      EAGVRQDCRHLVDFLCNRLTGQHRAWLEAHDGWDGFCLFF--------TP
                                     :   *      *:    **     :           

G1L3M8_MCL1-01         DLEGGIRNVLLAFAGVAGVGAGLAYLIR----
G1L3M8_MCL1-02         DLEGGIRNVLLAFAGVAGVGAGLAYLIR----
G1LID1_BCL2-02         --------------------------------
G1LMC3_BCL2L2-01       LREGNWASVRTVLTGAVALGALVTVGAFFASK
G1LID1_BCL2-01         LFDFSWLSLKALLSLAL-VGACITLGAYLGHK
G1LKR4_BCL2L10-01      MLPSSWKRLLAQALLSC-FTAVILIYFWKRLL
                                                       

© 1998-2019