Dataset for protein Mcl-1 of organism Acanthochromis polyacanthus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1EQB9_MCL1-01      MNMIPTKRTTLMNCLIFPQNGVVEGPMHYGSGDSSPQISVASSIDPQNGN
A0A3Q1EQB9_MCL1-02      MNMIPTKRTTLMNCLIFPQNGVVEGPMHYGSGDSSPQISVASSIDPQNGN
                        **************************************************

A0A3Q1EQB9_MCL1-01      LGSSDTPKRPKNLGVNGYAPKSLRQDSDSMEDGSLPCTPELQSDSETDVS
A0A3Q1EQB9_MCL1-02      LGSSDTPKRPKNLGVNGYAPKSLRQDSDSMEDGSLPCTPELQSDSETDVS
                        **************************************************

A0A3Q1EQB9_MCL1-01      SCPTGDELLENDTRQLIRRFLRDFTGLSKPRWNESKALSTMKRVVDDVLD
A0A3Q1EQB9_MCL1-02      SCPTGDELLENDTRQLIRRFLRDFTGLSKPRWNESKALSTMKRVVDDVLD
                        **************************************************

A0A3Q1EQB9_MCL1-01      KHRYSYNGMINKLSLDDIGDDVSFVSAVAKSLFADRTTNWGRITSLVAFG
A0A3Q1EQB9_MCL1-02      KHRYSYNGMINKLSLDDIGDDVSFVSAVAKSLFADRTTNWGRITSLVAFG
                        **************************************************

A0A3Q1EQB9_MCL1-01      AVVCQYLKERGRENCVDLVSQEISTYLLSEQRDWLVKNNSWDGFVEFFRV
A0A3Q1EQB9_MCL1-02      AVVCQYLKERGRENCVDLVSQEISTYLLSEQRDWLVKNNSWDGFVEFFRV
                        **************************************************

A0A3Q1EQB9_MCL1-01      ADPELTVRNTLMAFAGFAGIGATLALLIR---------------------
A0A3Q1EQB9_MCL1-02      ADPELTVRNTLMAFAGFAGIGATLALLIRLESKFGETQRTGRGAGGKRWI
                        *****************************                     

A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      QGGRRKPQERNRRRHDACRDRGRGQGNRQNWRVPRRGNQEGHGAGRGPRR
                                                                          

A0A3Q1EQB9_MCL1-01      ---------------------------------
A0A3Q1EQB9_MCL1-02      KQGDRLGRSGPDSGILQERRTEKKTLVSEILVT
                                                         

© 1998-2019