Dataset for protein BCL-2-like of organism Acanthochromis polyacanthus

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1GS47_BCL2L1-      MFRRHVKASYYVIGRQGRADVGGYVRAHTLVNTKWMCDILVELDSFLCAP
A0A3Q1EQB9_MCL1-01      ------------------------MNMIPTKRTTLMNCLIFPQNGVVEGP
A0A3Q1EQB9_MCL1-02      ------------------------MNMIPTKRTTLMNCLIFPQNGVVEGP
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1GS47_BCL2L1-      --------------------------------------------------
                                                                          

A0A3Q1GS47_BCL2L1-      SDRRTGDSVTERRTASRESRAFVSVLAGPELVCQPCVGLVFTPERPVDIS
A0A3Q1EQB9_MCL1-01      MHYGSGDSSPQISVASSIDPQ------------NGNLGSSDTPKRPKNLG
A0A3Q1EQB9_MCL1-02      MHYGSGDSSPQISVASSIDPQ------------NGNLGSSDTPKRPKNLG
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1GS47_BCL2L1-      --------------------------------------------------
                                                                          

A0A3Q1GS47_BCL2L1-      GPWW--------SEQRAAGRQPGTVCVHSNAARRTRATRTENTLARNMSQ
A0A3Q1EQB9_MCL1-01      VNGYAPKSLRQDSDSMEDGSLPCTPELQSDSETDVSSCPTGDELLEN--D
A0A3Q1EQB9_MCL1-02      VNGYAPKSLRQDSDSMEDGSLPCTPELQSDSETDVSSCPTGDELLEN--D
A0A3Q1GM98_BCL2L10      ---------------------------------------------MSCGL
A0A3Q1FLK7_BCL2-01      ---------------------------------------------MANEC
A0A3Q1EVP6_BCL2L1-      ----------------------------------------------MSCS
A0A3Q1GS47_BCL2L1-      -----------------------------------------------MSQ
                                                                          

A0A3Q1GS47_BCL2L1-      NRELVVFYIKYKLSQRNYPLNHMVLNEAPNRTDGGEARLGEDQRTETHAN
A0A3Q1EQB9_MCL1-01      TRQLIRRFLR----------------------------------------
A0A3Q1EQB9_MCL1-02      TRQLIRRFLR----------------------------------------
A0A3Q1GM98_BCL2L10      WKETVVLA---------------------------------EDYLSLCCA
A0A3Q1FLK7_BCL2-01      NRNIVEKYICHKLSKRGYVWGFDDVRDEDAANNG--SVVDPPPTLVRRCH
A0A3Q1EVP6_BCL2L1-      NRELVEFFISYKLSQRNYPMSLLRPEDAGGRTDG-------DKASSASSN
A0A3Q1GS47_BCL2L1-      NRELVVFYIKYKLSQRNYPLNHMVLNEAPNRTDGGEARLGEDQRTETHAN
                         .: :                                             

A0A3Q1GS47_BCL2L1-      GTFNGTSPGTPPPSPRRLASTATMDAVKEALRDTANEFELRYAR-----A
A0A3Q1EQB9_MCL1-01      -DFTGL-------SKPRWNESKALSTMKRVVDDVLDKHRYSYNGMINKLS
A0A3Q1EQB9_MCL1-02      -DFTGL-------SKPRWNESKALSTMKRVVDDVLDKHRYSYNGMINKLS
A0A3Q1GM98_BCL2L10      GPHQAPPPPSESA---------------AAMRRLAQDMEKQHQA-----R
A0A3Q1FLK7_BCL2-01      EASTGPDNESDPHLCRRLPQSDPHAAIHRVLREAGDELERLYQP-----D
A0A3Q1EVP6_BCL2L1-      GLLVNNRDG--------------IEAVKSTLKDAADEFELLFTQ-----T
A0A3Q1GS47_BCL2L1-      GTFNGTSPGTPPPSPRRLASTATMDAVKEALRDTANEFELRYAR-----A
                                                     .:    :.    .        

A0A3Q1GS47_BCL2L1-      FSDLHSQLHITPATAY-QSFENVMDEVFRDG-VNWGRIVGLFAFGGALCV
A0A3Q1EQB9_MCL1-01      LDDIGDDVSFVSAVAK-SLFAD-------RT-TNWGRITSLVAFGAVVCQ
A0A3Q1EQB9_MCL1-02      LDDIGDDVSFVSAVAK-SLFAD-------RT-TNWGRITSLVAFGAVVCQ
A0A3Q1GM98_BCL2L10      FHSLTQAFLRQCGPDFCSSLRMVMEELVEDGHLNWGRVVSLFTFTGVLAR
A0A3Q1FLK7_BCL2-01      FTEMSRQLYLTTTTAQ-RRFAEVIDELFRDG-VNWGRIIAFFEFGGTVCV
A0A3Q1EVP6_BCL2L1-      FSDLSSQIDITPETAY-HSFKSVMDEVFKDG-VNWGRIVGLFCFGGVLCV
A0A3Q1GS47_BCL2L1-      FSDLHSQLHITPATAY-QSFENVMDEVFRDG-VNWGRIVGLFAFGGALCV
                        : .:   .           :             ****: .:. * ..:. 

A0A3Q1GS47_BCL2L1-      ECVEK-EMSPLVG---------------RIVEWMTVYLDNHIQDWIQGQG
A0A3Q1EQB9_MCL1-01      YLKER-GRENCVD---------------LVSQEISTYLLSEQRDWLVKNN
A0A3Q1EQB9_MCL1-02      YLKER-GRENCVD---------------LVSQEISTYLLSEQRDWLVKNN
A0A3Q1GM98_BCL2L10      QLLEQKDTKPGLDPGKRQELGQRPVNCRGLAETIADYLGEEKKDWLLEND
A0A3Q1FLK7_BCL2-01      ECAAKEEMTSQVD---------------NIAEWMTEYLNGPLNSWIQDNG
A0A3Q1EVP6_BCL2L1-      ECVEK-NMSELVP---------------RIADWMTMYLDEHISPWIQSQG
A0A3Q1GS47_BCL2L1-      ECVEK-EMSPLVG---------------RIVEWMTVYLDNHIQDWIQGQG
                            .      :                 : : :: **      *:  :.

A0A3Q1GS47_BCL2L1-      GWERFAEIFG-QDAAAESRRSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
A0A3Q1EQB9_MCL1-01      SWDGFVEFFRVADPELTVRNTLMAFAGFAGIGATLALLIR----------
A0A3Q1EQB9_MCL1-02      SWDGFVEFFRVADPELTVRNTLMAFAGFAGIGATLALLIRLESKFGETQR
A0A3Q1GM98_BCL2L10      GWEGFCKF------SLSARKASQDLSMKTALFAAAGVGLAGLTFLLVR--
A0A3Q1FLK7_BCL2-01      GWDAFVELYD-RQRDSVFSCSWPSIKTVFGLAALGAASLTIGAYLTQK--
A0A3Q1EVP6_BCL2L1-      DWECFAEIFG-QNAAAEARRSRDTLKRWLLAGGVLLMGVLAGVLIAKKQ-
A0A3Q1GS47_BCL2L1-      GWERFAEIFG-QDAAAESRRSQESFKKWLLVGMTVVTGVVVGSLIAQKRL
                        .*: * ::            :   :             :           

A0A3Q1GS47_BCL2L1-      --------------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------------
A0A3Q1EQB9_MCL1-02      TGRGAGGKRWIQGGRRKPQERNRRRHDACRDRGRGQGNRQNWRVPRRGNQ
A0A3Q1GM98_BCL2L10      --------------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1GS47_BCL2L1-      --------------------------------------------------
                                                                          

A0A3Q1GS47_BCL2L1-      --------------------------------------------
A0A3Q1EQB9_MCL1-01      --------------------------------------------
A0A3Q1EQB9_MCL1-02      EGHGAGRGPRRKQGDRLGRSGPDSGILQERRTEKKTLVSEILVT
A0A3Q1GM98_BCL2L10      --------------------------------------------
A0A3Q1FLK7_BCL2-01      --------------------------------------------
A0A3Q1EVP6_BCL2L1-      --------------------------------------------
A0A3Q1GS47_BCL2L1-      --------------------------------------------
                                                                    

© 1998-2019