Dataset for protein Bcl-xL of organism Acanthochromis polyacanthus

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q1GS47_BCL2L1-      MFRRHVKASYYVIGRQGRADVGGYVRAHTLVNTKWMCDILVELDSFLCAP
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1GS47_BCL2L1-      --------------------------------------------------
                                                                          

A0A3Q1GS47_BCL2L1-      SDRRTGDSVTERRTASRESRAFVSVLAGPELVCQPCVGLVFTPERPVDIS
A0A3Q1EVP6_BCL2L1-      --------------------------------------------------
A0A3Q1GS47_BCL2L1-      --------------------------------------------------
                                                                          

A0A3Q1GS47_BCL2L1-      GPWWSEQRAAGRQPGTVCVHSNAARRTRATRTENTLARNMSQNRELVVFY
A0A3Q1EVP6_BCL2L1-      --------------------------------------MSCSNRELVEFF
A0A3Q1GS47_BCL2L1-      ---------------------------------------MSQNRELVVFY
                                                                ..***** *:

A0A3Q1GS47_BCL2L1-      IKYKLSQRNYPLNHMVLNEAPNRTDGGEARLGEDQRTETHANGTFNGTSP
A0A3Q1EVP6_BCL2L1-      ISYKLSQRNYPMSLLRPEDAGGRTDG-------DKASSASSNGLLVNNRD
A0A3Q1GS47_BCL2L1-      IKYKLSQRNYPLNHMVLNEAPNRTDGGEARLGEDQRTETHANGTFNGTSP
                        *.*********:. :  ::* .****       *: :.: :** : ..  

A0A3Q1GS47_BCL2L1-      GTPPPSPRRLASTATMDAVKEALRDTANEFELRYARAFSDLHSQLHITPA
A0A3Q1EVP6_BCL2L1-      G--------------IEAVKSTLKDAADEFELLFTQTFSDLSSQIDITPE
A0A3Q1GS47_BCL2L1-      GTPPPSPRRLASTATMDAVKEALRDTANEFELRYARAFSDLHSQLHITPA
                        *              ::***.:*.*:*:**** ::.:**** **: *** 

A0A3Q1GS47_BCL2L1-      TAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIV
A0A3Q1EVP6_BCL2L1-      TAYHSFKSVMDEVFKDGVNWGRIVGLFCFGGVLCVECVEKNMSELVPRIA
A0A3Q1GS47_BCL2L1-      TAYQSFENVMDEVFRDGVNWGRIVGLFAFGGALCVECVEKEMSPLVGRIV
                        ***:**:.******.************.***.********:** ** **.

A0A3Q1GS47_BCL2L1-      EWMTVYLDNHIQDWIQGQGGWERFAEIFGQDAAAESRRSQESFKKWLLVG
A0A3Q1EVP6_BCL2L1-      DWMTMYLDEHISPWIQSQGDWECFAEIFGQNAAAEARRSRDTLKRWLLAG
A0A3Q1GS47_BCL2L1-      EWMTVYLDNHIQDWIQGQGGWERFAEIFGQDAAAESRRSQESFKKWLLVG
                        :***:***:**. ***.**.** *******:****:***.:::*.***.*

A0A3Q1GS47_BCL2L1-      MTVVTGVVVGSLIAQKRL
A0A3Q1EVP6_BCL2L1-      GVLLMGVLAGVLIAKKQ-
A0A3Q1GS47_BCL2L1-      MTVVTGVVVGSLIAQKRL
                         .:: **:.* ***:*. 

© 1998-2019