Dataset for protein Bax of organism Equus caballus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


F6YGW2_BAX-02      MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGDTPELGLEEVPQDASTKKLS
F6YGW2_BAX-01      MDGSGEQPRGGG-------------------EDRAGRMGGDTPELGLEEVPQDASTKKLS
                   ************                   :****************************

F6YGW2_BAX-02      ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
F6YGW2_BAX-01      ECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAAEMFSDGNFNWGRVVALFYFASKL
                   ************************************************************

F6YGW2_BAX-02      VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSDFGSPTWQTVTIFVAGV
F6YGW2_BAX-01      VLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWVRPLGPLSPPPRRPPLRLWVTH
                   **************************************   *. :..*....   : .  

F6YGW2_BAX-02      LTASLTIWKKMG------------------------
F6YGW2_BAX-01      VADSDHLRGRSAHRLAHHLEEDGLRPPAALDCDSSA
                   :: *  :. . .                        

© 1998-2019