Dataset for protein BAX-like of organism Epinephelus coioides

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A142K3N5_BOK-01      MEMLRRSSVFAAEVFDRSPTDKELVSQAKALCRDYIHSRLNRAGIGWSKP
A0A219P128_BAX-01      -------MASHPGGGDQGKSKDDIMEVGADLLKDFIYQRVKRHGDGSTAV
                               .  .   *.. :..:::. .  * .*:*:.*::* * * :  

A0A142K3N5_BOK-01      EHGLAASGGALGE-----ISSVLLWLGDELEYLRPNVYRNVARQLNITVA
A0A219P128_BAX-01      TRE-QLGGGELCDPNTKRLARCLQQIGDELD-------GNVELQRMINDS
                        .    .** * :     ::  * .:****:        **  *  *. :

A0A142K3N5_BOK-01      SESIVSDAFLAVAADIFSTG-VTWGKVVSLYAVAGALAVDCVRHGHPAMV
A0A219P128_BAX-01      SLSPTKDMFIKVAIEIFSDGRFNWGRVVALFYFACRLVIKALVTHVPDII
                       * * ..* *: ** :*** * ..**.**:*: .*  *.:..:    * ::

A0A142K3N5_BOK-01      HTIVDCMGEFVRKSLTSWLKRRGGWVDVTKCVVNTDPSFRSHWLVCAVCA
A0A219P128_BAX-01      RTIISWTMDYLRENVINWIREQGGWEGIRAHFGT------PTWQTVGVFT
                       .**:.   :::*:.: .*:. .*** .:   . .      . * . .* :

A0A142K3N5_BOK-01      FGHYVKAIVLYLFREK
A0A219P128_BAX-01      AGVLTTLLVIYKM---
                        *  .. :*:* :   

© 1998-2019