Dataset for protein Bok of organism Danio rerio

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


Q6DC66_BOK-01          ---MEMLRRSSVFAAEVMEVFDRSPTDKELVSQSKVLCRDYIHSRLHRAG
B2GRX5_BOK-01          ---MNVFARSSVLAAEMIDVFDRTHTEKELVFQSKELCRDFIHSRITREG
Q7T381_BOK-01          ---MNVFARSSVLAAEMIDVFDRTHTEKELVFQSKELCRDFIHSRITREG
B0S7M3_BOK-01          MRDMNVFARSSVLAAEMMDVFDRTHTEKELVFQSKELCRDFIHSRITREG
A0A0R4IZP5_BOK-01      MKGMEMLRRSSVFAAEVMEVFDRSPTDKELVSQSKVLCRDYIHSRLHRAG
A0A0R4IZP5_BOK-02      MKGMEMLRRSSVFAAEVMEVFDRSPTDKELVSQSKVLCRDYIHSRLHRAG
                          *::: ****:***:::****: *:**** *** ****:****: * *

Q6DC66_BOK-01          IGWSKPE---HGSGGTLAEVSSVLLWLGDELEYLRPNVYRNVARQLNITI
B2GRX5_BOK-01          LSWSKVELDLPEPRGVLVDVSVVLLKLGDELECMRPYVYRNIAKQLNISV
Q7T381_BOK-01          LSWSKVELDLPEPRGVLVDVSVVLLKLGDELECMRPYVYRNIAKQLNISV
B0S7M3_BOK-01          LSWSKVELDLPEPRGVLVDVSVVLLKLGDELECMRPYVYRNIAKQLNISV
A0A0R4IZP5_BOK-01      IGWSKPE---HGSGGTLAEVSSVLLWLGDELEYLRPNVYRNVARQLNITI
A0A0R4IZP5_BOK-02      IGWSKPE---HGSGGTLAEVSSVLLWLGDELEYLRPNVYRNVARQLNITI
                       :.*** *     . *.*.:** ***.****** :** ****:*.****::

Q6DC66_BOK-01          ASENIVSDAFLAVAAEIFSTEYSRKGLEKHKGVTWGKIVSLYAVAGALAV
B2GRX5_BOK-01          SVEAVVSDAFLSVATEVIAM-----------GITWGKVVAIYAVAAGLAV
Q7T381_BOK-01          SVEAVVSDAFLSVATEVIAM-----------GITWGKVVAIYAVAAGLAV
B0S7M3_BOK-01          SVEAVVSDAFLSVATEVIAM-----------GITWGKVVAIYAVAAGLAV
A0A0R4IZP5_BOK-01      ASENIVSDAFLAVAAEIFSTEYSRKGLEKHKGVTWGKIVSLYAVAGALAV
A0A0R4IZP5_BOK-02      ASENIVSDAFLAVAAEIFSTG----SVCFFTGVTWGKIVSLYAVAGALAV
                       : * :******:**:*:::            *:****:*::****..***

Q6DC66_BOK-01          DCVRNGHPAMVHTIVDCMGEFVRKSLASWLKKRGGWADITKCVVSTDPSF
B2GRX5_BOK-01          DCVRLGHPVMVHTIVDSLGEFVRRSLVPWLKKRGGWVDILKCVVNMDSRA
Q7T381_BOK-01          DCVRLGHPVMVHTIVDSLGEFVRRSLVPWLKKRGGWVDILKCVVNMDSRA
B0S7M3_BOK-01          DCVRLGHPVMVHTIVDSLGEFVRRSLVPWLKKRGGWVDILKCVVNMDSRA
A0A0R4IZP5_BOK-01      DCVRHGHPAMVHTIVDCMGEFVRKSLASWLKKRGGWADITKCVVSTDPSF
A0A0R4IZP5_BOK-02      DCVRHGHPAMVHTIVDCMGEFVRKSLASWLKKRGGWADITKCVVSTDPSF
                       **** ***.*******.:*****.**..********.** ****. *.  

Q6DC66_BOK-01          HSHWLVTAACACGHYLKAVVFYLLREK
B2GRX5_BOK-01          HVHWLSTAVLTWREFIKTMYVYLTK--
Q7T381_BOK-01          HVHWLSTAVLTWREFIKTMYVYLTK--
B0S7M3_BOK-01          HVHWLSTAVLTWREFIKTMYVYLTK--
A0A0R4IZP5_BOK-01      HSHWLVTAACACGHYLKAVVFYLLREK
A0A0R4IZP5_BOK-02      HSHWLVTAACACGHYLKAVVFYLLREK
                       * *** **. :   ::*:: .** .  

© 1998-2019