Dataset for protein BAX-like of organism Danio rerio

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3ITC2_BAX-04          -------------------MEALLDYVVRIGSGNDQTLDAGSAVLFNFI-
D2Y5Q2_BCLWAV-01       ------------------MGRSDDAVIGRGLNSPDPLVREAFLMAYDYI-
I3ITC2_BAX-03          -------------------MEALLDYVVRIGSGNDQTLDAGSAVLFNFI-
Q9I9N4_BAX-03          --------------------MAAPSGGGDTGSGNDQILDLGAALLNNFV-
A9JSY8_BAX-01          MADGKNGETTDENELKGATGGEDVV--------DDAIIEQSAVLLRGYVI
Q08BX9_BAX-01          MADGKNGETTDENELKGATGGEDVV--------DDAIIEQSAVLLRGYVI
Q6DC66_BOK-01          ----------MEMLRRSSVFAAEVMEVFDRSPTDKELVSQSKVLCRDYI-
B2GRX5_BOK-01          ----------MNVFARSSVLAAEMIDVFDRTHTEKELVFQSKELCRDFI-
Q7T381_BOK-01          ----------MNVFARSSVLAAEMIDVFDRTHTEKELVFQSKELCRDFI-
B0S7M3_BOK-01          -------MRDMNVFARSSVLAAEMMDVFDRTHTEKELVFQSKELCRDFI-
A0A0R4IZP5_BOK-01      -------MKGMEMLRRSSVFAAEVMEVFDRSPTDKELVSQSKVLCRDYI-
A0A0R4IZP5_BOK-02      -------MKGMEMLRRSSVFAAEVMEVFDRSPTDKELVSQSKVLCRDYI-
                                                         .  :  .  :  .:: 

I3ITC2_BAX-04          --------FEWLHQHLDKEAEITCWLQNNLGIVEKSDPSHKDAIECMVRI
D2Y5Q2_BCLWAV-01       --------SYVTAKPGVPLCPAP-----------------SRASAALRHA
I3ITC2_BAX-03          --------FEWLHQHLDKEAEITCWLQNNLGIVEKSDPSHKDAIECMVRI
Q9I9N4_BAX-03          --------YERVRRHGDRDAEVT---RSQLGGVELCDPSHKRLAQCLQQI
A9JSY8_BAX-01          QQATIDDPNIHVSHETLG-GRPQ---DEEDPQI-------KEVVDQLLKI
Q08BX9_BAX-01          QQATIDDPNIHVSHETLG-GRPQ---DEEDPQI-------KEVVDQLLKI
Q6DC66_BOK-01          --------HSRLHRAGIGWSKPE---HGSGGTL-------AEVSSVLLWL
B2GRX5_BOK-01          --------HSRITREGLSWSKVELDLPEPRGVL-------VDVSVVLLKL
Q7T381_BOK-01          --------HSRITREGLSWSKVELDLPEPRGVL-------VDVSVVLLKL
B0S7M3_BOK-01          --------HSRITREGLSWSKVELDLPEPRGVL-------VDVSVVLLKL
A0A0R4IZP5_BOK-01      --------HSRLHRAGIGWSKPE---HGSGGTL-------AEVSSVLLWL
A0A0R4IZP5_BOK-02      --------HSRLHRAGIGWSKPE---HGSGGTL-------AEVSSVLLWL
                                    .                                : . 

I3ITC2_BAX-04          ANEME-------GNEELQGMLNSALLNPTLEHYILVVNGTFSDV------
D2Y5Q2_BCLWAV-01       GDELLIRFPIFFRRWPR--VFQDVTEHTACPTLLSILDEHFAPTRRR---
I3ITC2_BAX-03          ANEME-------GNEELQGMLNSALLNPTLEHYILVVNGTFSDV------
Q9I9N4_BAX-03          GDELD-------GNAQLQSMLNNSNLQPTQDVFIRVAREIFSDG------
A9JSY8_BAX-01          ADDLN-------KNAELQHLISTVQSNCAQDVFMTVARSIFDD-------
Q08BX9_BAX-01          ADDLN-------KNAELQHLISTVQSNCAQDVFMTVARSIFDD-------
Q6DC66_BOK-01          GDELEYLRPNVYRNVARQLNITIASENIVSDAFLAVAAEIFSTEYSRKGL
B2GRX5_BOK-01          GDELECMRPYVYRNIAKQLNISVSVEAVVSDAFLSVATEVIAM-------
Q7T381_BOK-01          GDELECMRPYVYRNIAKQLNISVSVEAVVSDAFLSVATEVIAM-------
B0S7M3_BOK-01          GDELECMRPYVYRNIAKQLNISVSVEAVVSDAFLSVATEVIAM-------
A0A0R4IZP5_BOK-01      GDELEYLRPNVYRNVARQLNITIASENIVSDAFLAVAAEIFSTEYSRKGL
A0A0R4IZP5_BOK-02      GDELEYLRPNVYRNVARQLNITIASENIVSDAFLAVAAEIFSTG----SV
                       .:::         .      :       .    : :    :         

I3ITC2_BAX-04          ----TLSWGC----------------------------------------
D2Y5Q2_BCLWAV-01       ----DLAWSAVLSVFVLAGQLALHCQDRGMEDITPQIQECVGSYVERV-I
I3ITC2_BAX-03          ----TLSWGSVVALFYVACRFVVKAAEINSVDLVRSIINWTMPFIRKTCI
Q9I9N4_BAX-03          ----KFNWGRVVALFYFACRLVIKAISTRVPDIIRTIISWTMSYIQEH-V
A9JSY8_BAX-01          ----GINWGRVVALFHLAYRLIFQALTQNHFEIIKNIISWFLQFMKKH-I
Q08BX9_BAX-01          ----GINWGRVVALFHLAYRLIFQALTQNHLEIIKNIISWFLQFMKKH-I
Q6DC66_BOK-01          EKHKGVTWGKIVSLYAVAGALAVDCVRNGHPAMVHTIVDCMGEFVRKS-L
B2GRX5_BOK-01          ----GITWGKVVAIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEFVRRS-L
Q7T381_BOK-01          ----GITWGKVVAIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEFVRRS-L
B0S7M3_BOK-01          ----GITWGKVVAIYAVAAGLAVDCVRLGHPVMVHTIVDSLGEFVRRS-L
A0A0R4IZP5_BOK-01      EKHKGVTWGKIVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKS-L
A0A0R4IZP5_BOK-02      CFFTGVTWGKIVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKS-L
                            . *.                                         

I3ITC2_BAX-04          --------------------------------------------------
D2Y5Q2_BCLWAV-01       CPEIRDKGGWSGFISRFGE-KQNLEDHVVKVCCWSLLLLCVGILSYFIWT
I3ITC2_BAX-03          LTWIREQGGWGAIRSYFGT------PTWQTVGVFLAGVLTVGLVLYKM--
Q9I9N4_BAX-03          INWIREQGGWDGIRSYFGT------PTWQTVGVFLAGVITTALVIRKM--
A9JSY8_BAX-01          SAWIRQQGGWEGIFRSM--------TRWRTVSTIAAVAFIVAV-VYWRRT
Q08BX9_BAX-01          SAWIRQQGGWEGIFRSM--------TRWRTVSTIAAVAFIVAV-VYWRRT
Q6DC66_BOK-01          ASWLKKRGGWADITKCVVSTDPSFHSHWLVTAACACGHYLKAVVFYLLRE
B2GRX5_BOK-01          VPWLKKRGGWVDILKCVVNMDSRAHVHWLSTAVLTWREFIKTMYVYLTK-
Q7T381_BOK-01          VPWLKKRGGWVDILKCVVNMDSRAHVHWLSTAVLTWREFIKTMYVYLTK-
B0S7M3_BOK-01          VPWLKKRGGWVDILKCVVNMDSRAHVHWLSTAVLTWREFIKTMYVYLTK-
A0A0R4IZP5_BOK-01      ASWLKKRGGWADITKCVVSTDPSFHSHWLVTAACACGHYLKAVVFYLLRE
A0A0R4IZP5_BOK-02      ASWLKKRGGWADITKCVVSTDPSFHSHWLVTAACACGHYLKAVVFYLLRE
                                                                         

I3ITC2_BAX-04          ----
D2Y5Q2_BCLWAV-01       RRKT
I3ITC2_BAX-03          ----
Q9I9N4_BAX-03          ----
A9JSY8_BAX-01          R---
Q08BX9_BAX-01          R---
Q6DC66_BOK-01          K---
B2GRX5_BOK-01          ----
Q7T381_BOK-01          ----
B0S7M3_BOK-01          ----
A0A0R4IZP5_BOK-01      K---
A0A0R4IZP5_BOK-02      K---
                           

© 1998-2019