Dataset for protein Bax of organism Danio rerio

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


I3ITC2_BAX-04      -----------MEALLDYVVRIGSGNDQTLDAGSAVLFNFIFEWLHQHLDKEAEITCWLQ
A9JSY8_BAX-01      MADGKNGETTDENELKGATGGEDVVDDAIIEQSAVLLRGYVIQQATID-DPNIHVS---H
Q08BX9_BAX-01      MADGKNGETTDENELKGATGGEDVVDDAIIEQSAVLLRGYVIQQATID-DPNIHVS---H
I3ITC2_BAX-03      -----------MEALLDYVVRIGSGNDQTLDAGSAVLFNFIFEWLHQHLDKEAEITCWLQ
Q9I9N4_BAX-03      ------------MAAPSGGGDTGSGNDQILDLGAALLNNFVYERVRRHGDRDAEVT---R
                                   .     .  :*  :: .:.:* .:: :.     * :  ::   .

I3ITC2_BAX-04      NNLGI--VEKSDPSHKDAIECMVRIANEMEGNEELQGMLNSALLNPTLEHYILVVNGTFS
A9JSY8_BAX-01      ETLGGRPQDEEDPQIKEVVDQLLKIADDLNKNAELQHLISTVQSNCAQDVFMTVARSIFD
Q08BX9_BAX-01      ETLGGRPQDEEDPQIKEVVDQLLKIADDLNKNAELQHLISTVQSNCAQDVFMTVARSIFD
I3ITC2_BAX-03      NNLGI--VEKSDPSHKDAIECMVRIANEMEGNEELQGMLNSALLNPTLEHYILVVNGTFS
Q9I9N4_BAX-03      SQLGG--VELCDPSHKRLAQCLQQIGDELDGNAQLQSMLNNSNLQPTQDVFIRVAREIFS
                   . **    :  **. *   : : .*.:::: * :** ::..   : : : :: *..  *.

I3ITC2_BAX-04      DVTLSWGC----------------------------------------------------
A9JSY8_BAX-01      DG-INWGRVVALFHLAYRLIFQALTQNHFEIIKNIISWFLQFMKKH-ISAWIRQQGGWEG
Q08BX9_BAX-01      DG-INWGRVVALFHLAYRLIFQALTQNHLEIIKNIISWFLQFMKKH-ISAWIRQQGGWEG
I3ITC2_BAX-03      DVTLSWGSVVALFYVACRFVVKAAEINSVDLVRSIINWTMPFIRKTCILTWIREQGGWGA
Q9I9N4_BAX-03      DGKFNWGRVVALFYFACRLVIKAISTRVPDIIRTIISWTMSYIQEH-VINWIREQGGWDG
                   *  :.**                                                     

I3ITC2_BAX-04      --------------------------------
A9JSY8_BAX-01      I--FRSMTRWRTVSTIAAVAFIVAVVYWRRTR
Q08BX9_BAX-01      I--FRSMTRWRTVSTIAAVAFIVAVVYWRRTR
I3ITC2_BAX-03      IRSYFGTPTWQTVGVFLAGVLTVGLVLYKM--
Q9I9N4_BAX-03      IRSYFGTPTWQTVGVFLAGVITTALVIRKM--
                                                   

© 1998-2019