Dataset for protein Bok of organism Cyprinodon variegatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2EB70_BOK-01      MVEEERRLATLTYDTL-RFGEFEDFPETSEPVWILGKEYNALTEKDEILS
A0A3Q2DRF3_BOK-01      -MDVLRRSSMFASEVLDVFDRSVTEKELVSQSKALCRDY-----------
A0A3Q2EB70_BOK-03      -MEMLRRSSVFAAE---VFDRSPTDKELVSQAKALCRDY-----------
A0A3Q2EB70_BOK-02      -MEMLRRSSVFAAE---VFDRSPTDKELVSQAKALCRDY-----------
                        ::  ** : :: :    *.      *  .  . * .:*           

A0A3Q2EB70_BOK-01      DVTSRL------WFTYRKNFPPIGGTGPTSDTGWGCMLRCGQMILGEALM
A0A3Q2DRF3_BOK-01      -ILSRLNQNGLGWSKTELNFSPSNAA-----------------VAEVSQV
A0A3Q2EB70_BOK-03      -IHSRLHRAGVGWSKAEQGSAAAGGK-----------------LAEVSAV
A0A3Q2EB70_BOK-02      -IHSRLHRAGVGWSKAEQGSAAAGGK-----------------LAEVSAV
                        : ***      * .   . .. ..                  :   : :

A0A3Q2EB70_BOK-01      CRHLGRDWRWAREQKQREEYISILNAFIDKKDSYYSIHQIGELSSSELCA
A0A3Q2DRF3_BOK-01      LLCLGDELESIQPTLYR------------------------NVARQLNIS
A0A3Q2EB70_BOK-03      VQWLGDELEYLRPNVYR------------------------NVARQLNIS
A0A3Q2EB70_BOK-02      VQWLGDELEYLRPNVYR------------------------NVARQLNIS
                          ** :    .    *                        ::: .   :

A0A3Q2EB70_BOK-01      LPLTGFHSTVFVVSAAAQMGVGEGKPIGQWYGPNTVAQVLKKLAVFDTWS
A0A3Q2DRF3_BOK-01      VAMENVVSDAFLSVATEIFAAGI------------------------TWG
A0A3Q2EB70_BOK-03      VAIEGVVSDAFMAIAADIFSTGV------------------------TWG
A0A3Q2EB70_BOK-02      VAIEGVVSDAFMAIAADIFSTGV------------------------TWG
                       :.: .. * .*:  *:  :..*                         **.

A0A3Q2EB70_BOK-01      RLVVHVAMDNTVIIEEIKRLCMPWLDLAGEAEGEAEVNGCLEGACALAEE
A0A3Q2DRF3_BOK-01      KVVAMYAVAGALAVDCVRQGHPTTVHIIVDSLGQ----------------
A0A3Q2EB70_BOK-03      KVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGE----------------
A0A3Q2EB70_BOK-02      KVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGE----------------
                       .:*   *: .:: :: :..   . :    :. *:                

A0A3Q2EB70_BOK-01      EAALWRPLVLLIPLRLGLSDINEAYIETLKQCFMLPQSLGVIGGKPNSAH
A0A3Q2DRF3_BOK-01      --FVRKFLVHWLKRKGGWAEIMKC--------------------------
A0A3Q2EB70_BOK-03      --FVRKSLTPWLKKRGGWADITKC--------------------------
A0A3Q2EB70_BOK-02      --FVRKSLTPWLKKRGGWADITKC--------------------------
                          :.. *.  :  . * ::* :.                          

A0A3Q2EB70_BOK-01      YFIGYVGEELIYLDPHTTQPAVEPSEDGQVPDETYHCQHPPCRMHICELD
A0A3Q2DRF3_BOK-01      ---------------------------------------------VVKMD
A0A3Q2EB70_BOK-03      ---------------------------------------------VVNTS
A0A3Q2EB70_BOK-02      ---------------------------------------------VVNTS
                                                                    : : .

A0A3Q2EB70_BOK-01      PSIAAGFFCQTEDDFDDWCLRIRRLSCKKGGLPMFELVDSQPVHMVSVDA
A0A3Q2DRF3_BOK-01      CTPERPWLSSVMDSFKYFLTTVYVYIMKEQ--------------------
A0A3Q2EB70_BOK-03      PPFYSHWLVSAVFAFGHYLKAVVLYLLREK--------------------
A0A3Q2EB70_BOK-02      PPFYSHWLVSAVFAFGHYLKAVVLYLLREK--------------------
                        .    :: ..   *  :   :     .:                     

A0A3Q2EB70_BOK-01      LNLTPDFSDSDRLERFFDSEDEEFEILSL
A0A3Q2DRF3_BOK-01      -----------------------------
A0A3Q2EB70_BOK-03      -----------------------------
A0A3Q2EB70_BOK-02      -----------------------------
                                                    

© 1998-2019