Dataset for protein BAX-like of organism Cyprinodon variegatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2EB70_BOK-01      ------------MVEEERRLATLTYDTLRFGEFEDFPETSEPVWILGKEY
A0A3Q2DRF3_BOK-01      -------------MDVLRRSSMFASEVL-------------------DVF
A0A3Q2EB70_BOK-03      -------------MEMLRRSSVFAAE----------------------VF
A0A3Q2EB70_BOK-02      -------------MEMLRRSSVFAAE----------------------VF
A0A3Q2DXF3_BAX-01      ---------------MCLICTLYSLQMF-------------------SSF
A0A3Q2E537_BAX-01      MAEGGGGDQGNPVDPMVEVGAVL----L-------------------KDF
A0A3Q2DXF3_BAX-03      SFIQTLQCCGASYLQMCLICTLYSLQMF-------------------SSF
A0A3Q2DXF3_BAX-02      --------MLASHTSQERVSSILCLNNT-------------------SIF
                                           :                            :

A0A3Q2EB70_BOK-01      NALTEKDEILSDVTSRLWFTYRKNFPPIGGTGPTSDTGWGCMLRCGQMIL
A0A3Q2DRF3_BOK-01      DRSVTEKELVSQSK----------------------------------AL
A0A3Q2EB70_BOK-03      DRSPTDKELVSQAK----------------------------------AL
A0A3Q2EB70_BOK-02      DRSPTDKELVSQAK----------------------------------AL
A0A3Q2DXF3_BAX-01      VVKWIQRHALSKVP----------------------------------IL
A0A3Q2E537_BAX-01      IYQRIRRHVDGDTD----------------------------------VT
A0A3Q2DXF3_BAX-03      VVKWIQRHALSKVP----------------------------------IL
A0A3Q2DXF3_BAX-02      VVKWIQRHALSKVP----------------------------------IL
                                 ..                                      

A0A3Q2EB70_BOK-01      GEALMCRHL--------GRDWRWAREQKQREEYISILNAFIDKKDSYYSI
A0A3Q2DRF3_BOK-01      CRDYILSRLNQNGLGWSKTELNFSPSNAAVAEVSQVLLCLGD--------
A0A3Q2EB70_BOK-03      CRDYIHSRLHRAGVGWSKAEQGSAAAGGKLAEVSAVVQWLGD--------
A0A3Q2EB70_BOK-02      CRDYIHSRLHRAGVGWSKAEQGSAAAGGKLAEVSAVVQWLGD--------
A0A3Q2DXF3_BAX-01      QEALGVTAL----------------CDPQQQKVSDAFQVVAD--------
A0A3Q2E537_BAX-01      REQLGATEL----------------CDPNHLKLAQCLQQIGDELDGNMEL
A0A3Q2DXF3_BAX-03      QEALGVTAL----------------CDPQQQKVSDAFQVVADEVDGEGGI
A0A3Q2DXF3_BAX-02      QEALGVTAL----------------CDPQQQKVSDAFQVVAD--------
                               *                      :    .  . *        

A0A3Q2EB70_BOK-01      HQIGELSSSELC-----------ALPLTGFHSTVFVVSAAAQMGVGEGKP
A0A3Q2DRF3_BOK-01      ----ELESIQPTLYRNVARQLNISVAMENVVSDAFLSVATEIFAAG-IT-
A0A3Q2EB70_BOK-03      ----ELEYLRPNVYRNVARQLNISVAIEGVVSDAFMAIAADIFSTG-VT-
A0A3Q2EB70_BOK-02      ----ELEYLRPNVYRNVARQLNISVAIEGVVSDAFMAIAADIFSTG-VT-
A0A3Q2DXF3_BAX-01      ----EVPSFTPS-------------------KEVFVKIVRELFSDGEIN-
A0A3Q2E537_BAX-01      QRMIEDSALKPT-------------------KDVFMKVALQIFSDGRFN-
A0A3Q2DXF3_BAX-03      KKLIEVPSFTPS-------------------KEVFVKIVRELFSDGEIN-
A0A3Q2DXF3_BAX-02      ----EVPSFTPS-------------------KEVFVKIVRELFSDGEIN-
                           *                          . .*:  .   :. *  . 

A0A3Q2EB70_BOK-01      IGQWYGPNTVAQVLKKLAVFDTWSRLVVHVAMDNTVIIEEIKRLCMPWLD
A0A3Q2DRF3_BOK-01      ---WGKVVAMYAVAGALAVDCVRQGHPTTVHIIVDSLGQFVRKFLVHWLK
A0A3Q2EB70_BOK-03      ---WGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLTPWLK
A0A3Q2EB70_BOK-02      ---WGKVVSLYAVAGALAVDCVRHGHPAMVHTIVDCMGEFVRKSLTPWLK
A0A3Q2DXF3_BAX-01      ---WGRVVTVFCFAGMFVLKAHESKICELIKTIISWIIDFFREKVLGWIK
A0A3Q2E537_BAX-01      ---WGRVVALFYFACRLVIKALITKIPEIIRTIINWTIDYIRDHVINWIR
A0A3Q2DXF3_BAX-03      ---WGRVVTVFCFAGMFVLKAHESKICELIKTIISWIIDFFREKVLGWIK
A0A3Q2DXF3_BAX-02      ---WGRVVTVFCFAGMFVLKAHESKICELIKTIISWIIDFFREKVLGWIK
                          *    ::  .   :.:          :        : ..     *: 

A0A3Q2EB70_BOK-01      LAGEAEGEAEVNGCLEGACALAEEEAALWRPLVLLIPLRLGLSDINEAYI
A0A3Q2DRF3_BOK-01      RKGGWA------EIMKCVVKMDCTPERPWLSSVMDSF----------KYF
A0A3Q2EB70_BOK-03      KRGGWA------DITKCVVNTSPPFYSHWLVSAVFAF----------GHY
A0A3Q2EB70_BOK-02      KRGGWA------DITKCVVNTSPPFYSHWLVSAVFAF----------GHY
A0A3Q2DXF3_BAX-01      EQGGWE------GIFSYVG------IPMWQFLGIFLA----------GVV
A0A3Q2E537_BAX-01      EQGGWE------GIRSYFG------TPTWQTVGVFLA----------GVL
A0A3Q2DXF3_BAX-03      EQGGWE------GIFSYVG------IPMWQFLGIFLA----------GVV
A0A3Q2DXF3_BAX-02      EQGGWE------GIFSYVG------IPMWQFLGIFLA----------GVV
                         *            .            *    :                

A0A3Q2EB70_BOK-01      ETLKQCFMLPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPSE
A0A3Q2DRF3_BOK-01      LTTVYVYIMKEQ--------------------------------------
A0A3Q2EB70_BOK-03      LKAVVLYLLREK--------------------------------------
A0A3Q2EB70_BOK-02      LKAVVLYLLREK--------------------------------------
A0A3Q2DXF3_BAX-01      TTLQTKKLMGGFTE------------------------------------
A0A3Q2E537_BAX-01      ATVFVMRKM-----------------------------------------
A0A3Q2DXF3_BAX-03      TTLVVVHKMRAE--------------------------------------
A0A3Q2DXF3_BAX-02      TTLVVVHKMRAE--------------------------------------
                        .      :                                         

A0A3Q2EB70_BOK-01      DGQVPDETYHCQHPPCRMHICELDPSIAAGFFCQTEDDFDDWCLRIRRLS
A0A3Q2DRF3_BOK-01      --------------------------------------------------
A0A3Q2EB70_BOK-03      --------------------------------------------------
A0A3Q2EB70_BOK-02      --------------------------------------------------
A0A3Q2DXF3_BAX-01      --------------------------------------------------
A0A3Q2E537_BAX-01      --------------------------------------------------
A0A3Q2DXF3_BAX-03      --------------------------------------------------
A0A3Q2DXF3_BAX-02      --------------------------------------------------
                                                                         

A0A3Q2EB70_BOK-01      CKKGGLPMFELVDSQPVHMVSVDALNLTPDFSDSDRLERFFDSEDEEFEI
A0A3Q2DRF3_BOK-01      --------------------------------------------------
A0A3Q2EB70_BOK-03      --------------------------------------------------
A0A3Q2EB70_BOK-02      --------------------------------------------------
A0A3Q2DXF3_BAX-01      --------------------------------------------------
A0A3Q2E537_BAX-01      --------------------------------------------------
A0A3Q2DXF3_BAX-03      --------------------------------------------------
A0A3Q2DXF3_BAX-02      --------------------------------------------------
                                                                         

A0A3Q2EB70_BOK-01      LSL
A0A3Q2DRF3_BOK-01      ---
A0A3Q2EB70_BOK-03      ---
A0A3Q2EB70_BOK-02      ---
A0A3Q2DXF3_BAX-01      ---
A0A3Q2E537_BAX-01      ---
A0A3Q2DXF3_BAX-03      ---
A0A3Q2DXF3_BAX-02      ---
                          

© 1998-2019