Dataset for protein Bax of organism Cyprinodon variegatus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3Q2DXF3_BAX-01      ---------------MCLICTLYSLQMFSSFVVKWIQRHALSKVPILQEA
A0A3Q2E537_BAX-01      MAEGGGGDQGNPVDPMVEVGAVL----LKDFIYQRIRRHVDGDTDVTREQ
A0A3Q2DXF3_BAX-03      SFIQTLQCCGASYLQMCLICTLYSLQMFSSFVVKWIQRHALSKVPILQEA
A0A3Q2DXF3_BAX-02      --------MLASHTSQERVSSILCLNNTSIFVVKWIQRHALSKVPILQEA
                                         : ::      . *: :.*.**. ... : .* 

A0A3Q2DXF3_BAX-01      LGVTALCDPQQQKVSDAFQVVAD------------EVPSFTPSKEVFVKI
A0A3Q2E537_BAX-01      LGATELCDPNHLKLAQCLQQIGDELDGNMELQRMIEDSALKPTKDVFMKV
A0A3Q2DXF3_BAX-03      LGVTALCDPQQQKVSDAFQVVADEVDGEGGIKKLIEVPSFTPSKEVFVKI
A0A3Q2DXF3_BAX-02      LGVTALCDPQQQKVSDAFQVVAD------------EVPSFTPSKEVFVKI
                       **.* ****:: *:::.:* :.*            * .::.*:*:**:*:

A0A3Q2DXF3_BAX-01      VRELFSDGEINWGRVVTVFCFAGMFVLKAHESKICELIKTIISWIIDFFR
A0A3Q2E537_BAX-01      ALQIFSDGRFNWGRVVALFYFACRLVIKALITKIPEIIRTIINWTIDYIR
A0A3Q2DXF3_BAX-03      VRELFSDGEINWGRVVTVFCFAGMFVLKAHESKICELIKTIISWIIDFFR
A0A3Q2DXF3_BAX-02      VRELFSDGEINWGRVVTVFCFAGMFVLKAHESKICELIKTIISWIIDFFR
                       . ::**** :******::* **  :*:**  :** *:*.***.* **::*

A0A3Q2DXF3_BAX-01      EKVLGWIKEQGGWEGIFSYVGIPMWQFLGIFLAGVVTTLQTKKLMGGFTE
A0A3Q2E537_BAX-01      DHVINWIREQGGWEGIRSYFGTPTWQTVGVFLAGVLATVFVMRKM-----
A0A3Q2DXF3_BAX-03      EKVLGWIKEQGGWEGIFSYVGIPMWQFLGIFLAGVVTTLVVVHKMRAE--
A0A3Q2DXF3_BAX-02      EKVLGWIKEQGGWEGIFSYVGIPMWQFLGIFLAGVVTTLVVVHKMRAE--
                       ::*:.**.******** **.* * ** :*:*****::*: . . *     

© 1998-2019