Dataset for protein Bok of organism Cynoglossus semilaevis

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3P8VGS5_BOK-01      MEMLRRSSVFAAE---VFDRSPTDKELVSQAKALCRDYINSRLNRVGMGW
A0A3P8WH41_BOK-01      MEVLRRSSVFAAEVLDVFDRSLTEKDLVSQSKALCRDYILFRLNQNGLGW
                       **:**********   ***** *:*:****:********  ***. *:**

A0A3P8VGS5_BOK-01      TSPEHGLASSSGTMREISSVLLWLGDELEYLRPNVYRNVARQLNITVASE
A0A3P8WH41_BOK-01      SKSELNLVPSNAALAEVSSVLLCLGDELECLQPSLYRNVARQLSISVAME
                       :..* .*..*..:: *:***** ****** *.*.:********.*:** *

A0A3P8VGS5_BOK-01      SVVSDAFLAVAADIFSTGITWGKVVSLYAVAGALAVDCVRHGHPSIVHTI
A0A3P8WH41_BOK-01      NMVSDAFIGVSTEIFATGITWGKVVAMYAVAAALAVDCVRQDRAANVNII
                       .:*****:.*:::**:*********::****.********:...: *: *

A0A3P8VGS5_BOK-01      VDCMGEFVRKSLTSWLKKRGGWMDVTKCVVNTDPRFSSHWLVMAACTFGH
A0A3P8WH41_BOK-01      VQSLGQFVRKFLVSWLKRRGGWGDITKCVVKKDFPPEQNWLTSVMESLKY
                       *:.:*:**** *.****.**** *:*****:.*   ..:**. .  :: :

A0A3P8VGS5_BOK-01      YVKTIVLYLLREK
A0A3P8WH41_BOK-01      FLTTVYVYIMKEP
                       ::.*: :*::.* 

© 1998-2019